Recombinant Bovine Acyl-CoA-binding domain-containing protein 5 (ACBD5)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bovine Acyl-CoA-Binding Domain-Containing Protein 5 (ACBD5)

Acyl-CoA-binding domain-containing protein 5 (ACBD5) is a protein that, in humans, is encoded by the ACBD5 gene . ACBD5 is an Acyl-CoA binding protein that acts as the peroxisome receptor for pexophagy . Research indicates that ACBD5 plays a crucial role in mediating membrane associations between the endoplasmic reticulum (ER) and peroxisomes, influencing peroxisome biogenesis, lipid transfer, and metabolism . ACBD5 deficiency is associated with progressive leukodystrophy, ataxia, and retinal dystrophy .

Gene Information

The ACBD5 gene provides instructions for producing the ACBD5 protein . The protein contains an Acyl-CoA binding domain. It is involved in several cellular processes, including peroxisome dynamics and lipid metabolism . Genetic variations in ACBD5 have been linked to severe neurological disorders, highlighting its importance in maintaining cellular health and function .

Protein Structure and Function

ACBD5 contains an acyl-CoA-binding domain, which is essential for its function in lipid metabolism . The protein facilitates the transfer of very long-chain fatty acids (VLCFAs) and is involved in peroxisome biogenesis . ACBD5 interacts with VAPB (VAMP associated protein B) to tether peroxisomes to the ER, influencing peroxisome size and movement .

Role in Peroxisome Dynamics

ACBD5 is critical for maintaining the structure and function of peroxisomes, which are organelles involved in various metabolic pathways . ACBD5 affects peroxisome motility; its absence leads to increased peroxisome movement . Furthermore, ACBD5 is required for the expansion of the peroxisomal membrane, a process essential for peroxisome formation via membrane growth and division .

ACBD5 and ER Interactions

ACBD5 mediates the interaction between peroxisomes and the ER, which is vital for lipid transfer and peroxisome biogenesis . Overexpression of ACBD4 in ACBD5 KO cells can restore peroxisome-ER contacts, indicating a compensatory mechanism . Studies using mutant forms of ACBD5, such as FFAT mutants, have shown that ER tethering is crucial for the proper metabolism of VLCFAs .

Clinical Significance of ACBD5 Deficiency

Deficiency in ACBD5 results in severe clinical phenotypes, including progressive leukodystrophy, ataxia, progressive microcephaly, facial dysmorphisms, and retinal dystrophy . Lipid profiling in patients with ACBD5 deficiency shows an accumulation of VLCFAs and a decrease in ether phospholipids, including plasmalogens . A novel homozygous intronic splice site variant in ACBD5 was identified in a patient with neuromotor deterioration and visual impairment, underscoring the genetic basis of ACBD5-related disorders . ACBD5 is definitively associated with ACBD5 deficiency .

Impact on Lipid Metabolism

ACBD5 plays a significant role in lipid metabolism, particularly in the processing of VLCFAs . Loss of ACBD5 leads to increased levels of C26:0 and C26:0-lysoPC, indicating impaired VLCFA metabolism . ACBD4 and ACBD5 have differential roles in lipid metabolism, with ACBD5 primarily involved in VLCFA recruitment .

ACBD5 and Disease Models

Amyotrophic lateral sclerosis (ALS)-associated VAPB mutants require ACBD5 to induce peroxisome clustering, indicating a link between ACBD5 and neurodegenerative diseases . Studies using ACBD5-deficient mouse models have shown similarities with ACBD5-deficient patient cell lines, providing valuable insights into disease mechanisms .

Experimental Evidence

ExperimentFindingsReference
ACBD5 SilencingIncreased peroxisomal movement, reduced peroxisomal membrane expansion
ACBD5 and VAPB CoexpressionPOs and microsomes partially comigrated, showing comparable maxima for marker proteins, suggesting a tighter association between both organelles in cells coexpressing ACBD5 and VAPB, creating PO–ER structures with altered buoyant densities, supporting a role for ACBD5 and VAPB in PO–ER association.
Overexpression of ACBD4 in ACBD5 KO CellsRestored peroxisome-ER contacts
VLCFA Analysis in ACBD5 KO CellsIncreased levels of C26:0 and C26:0-lysoPC
VAPB Mutant (P56S) OverexpressionInduced peroxisome aggregation, which was not observed in cells depleted of ACBD5

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. Please inform us of your required tag type for preferential development.
Synonyms
ACBD5; DBI; Acyl-CoA-binding domain-containing protein 5; Endozepine-related protein; Membrane-associated diazepam-binding inhibitor; MA-DBI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-533
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
ACBD5
Target Protein Sequence
MFQFHAGSWESWCCCCCLIPGDRPWDRGRRWRLEMADTRSVHETRFEAAVKVIQSLPKNG SFQPTNEMMLKFYSFYKQATEGPCKLSKPGFWDPVGRYKWDAWSSLGDMTKEEAMIAYVE EMKKILETMPMTEKVEELLHVIGPFYEIVEDKKSGRSSDLTSVRLEKISKCLEDLGNVLA STPNAKTVNGKAESSDSGAESEEEAAQEDPKRPEPRDSDKKMMKKSADHKNLEIIVTNGY DKDSFVQGVQNSIHTSPSLNGRCTEEVKSVDENLEQTGKTVVFVHQDVNSDHVEDISGIQ HLTSDSDSEVYCDSMEQFGQEESLDGFISNNGPFSYYLGGNPSQPLESSGFPEAVQGLPG NGSPEDMQGAVVEGKGEVKRGGEDGGSNSGAPHREKRAGESEEFSNIRRGRGHRMQHLSE GSKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLHKLEMLAASQAK SSALQTSNQPTSPRPSWWPFEMSPGALTFAIIWPFIAQWLVHLYYQRRRRKLN
Uniprot No.

Target Background

Function
Acyl-CoA binding protein functioning as a peroxisome receptor for pexophagy; however, it is not essential for aggrephagy or nonselective autophagy. It binds medium- and long-chain acyl-CoA esters.
Gene References Into Functions
  1. Role of acyl-coenzyme A binding protein as an intermembrane transporter of acyl-CoA. PMID: 14527695
  2. Evidence shows the presence of precursors to the folding transition state of bovine acyl-coenzyme A binding protein under acid-unfolding conditions. PMID: 15178258
Database Links
Protein Families
ATG37 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.
Tissue Specificity
Highly expressed in brain and liver. Lower levels of expression in spleen and heart.

Q&A

What is the basic structure of bovine ACBD5 and how does it compare to human ACBD5?

Bovine ACBD5, like its human counterpart, is a peroxisomal tail-anchored membrane protein characterized by an N-terminal acyl-CoA binding domain (ACBD) and a transmembrane domain (TMD) near its C-terminus. The ACBD is exposed to the cytosol while the C-terminal region anchors the protein to the peroxisomal membrane .

Structurally, ACBD5 possesses:

  • An N-terminal acyl-CoA binding domain (approximately 80 amino acids)

  • A central region containing an FFAT-like motif (two phenylalanines in an acidic tract)

  • A C-terminal transmembrane domain

  • A short luminal domain in the peroxisome

The bovine protein likely shares high sequence homology with human ACBD5, especially in the functional domains such as the ACBD and the FFAT-like motif, though species-specific variations may affect binding affinities and interaction partners .

What are the primary functions of ACBD5 in cellular metabolism?

ACBD5 plays several important roles in cellular metabolism:

  • Peroxisomal VLCFA β-oxidation: ACBD5 facilitates the efficient transport of very-long-chain fatty acyl-CoAs (VLC-CoAs) into peroxisomes for subsequent β-oxidation. It captures VLC-CoAs on the cytosolic side of the peroxisomal membrane, which is a crucial step for their metabolism .

  • Peroxisome-ER tethering: ACBD5 interacts with the ER-resident protein VAPB through its FFAT-like motif, forming a tethering complex that physically connects peroxisomes to the ER. This contact is important for lipid metabolism, including the metabolism of VLCFAs and plasmalogens .

  • Lipid homeostasis: ACBD5 deficiency leads to accumulation of phospholipids containing VLCFAs, suggesting its role in maintaining proper lipid composition in cellular membranes .

  • Potential role in peroxisome dynamics: While not conclusively established for bovine ACBD5, the protein has been suggested to be involved in basal autophagic degradation of peroxisomes (pexophagy) in mammalian cells .

What are the optimal expression systems for producing recombinant bovine ACBD5?

For recombinant bovine ACBD5 expression, researchers should consider several expression systems based on experimental needs:

Bacterial Expression Systems (E. coli):

  • Advantages: High yield, cost-effective, rapid growth

  • Limitations: May lack post-translational modifications, potential issues with membrane protein folding

  • Recommended strains: BL21(DE3), Rosetta 2(DE3) for rare codon optimization

  • Expression conditions: IPTG induction (0.1-1.0 mM) at lower temperatures (16-25°C) to improve protein solubility

Mammalian Expression Systems:

  • Advantages: Proper post-translational modifications, correct protein folding

  • Recommended cell lines: HEK293, CHO cells

  • Expression vectors: pCMV-based vectors with strong promoters

Insect Cell Systems:

  • Advantages: Balance between bacterial and mammalian systems, good for membrane proteins

  • Baculovirus expression vector system using Sf9 or Hi5 cells

The choice should be guided by whether the full-length protein (including the transmembrane domain) or only the soluble N-terminal ACBD is required. For functional studies of acyl-CoA binding, expressing just the ACBD in E. coli may be sufficient, as demonstrated with other ACBD proteins .

What purification protocols yield the highest purity and activity for recombinant ACBD5?

A multi-step purification protocol for recombinant bovine ACBD5 typically includes:

  • Affinity Chromatography:

    • For His-tagged ACBD5: Ni-NTA chromatography with imidazole gradient elution

    • For GST-tagged ACBD5: Glutathione-Sepharose with glutathione elution

    • Recommended buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitors

  • Ion Exchange Chromatography:

    • Q-Sepharose or SP-Sepharose depending on the isoelectric point

    • Salt gradient: 0-500 mM NaCl in 20 mM Tris-HCl pH 7.5

  • Size Exclusion Chromatography:

    • Superdex 75 or 200 column depending on protein size

    • Buffer: 20 mM HEPES pH 7.4, 150 mM NaCl, 1 mM DTT

For membrane-bound full-length ACBD5, detergent solubilization is necessary:

  • Initial solubilization: 1% DDM or 1% Triton X-100

  • Purification buffers should contain 0.05-0.1% detergent to maintain protein solubility

For optimal activity preservation:

  • Add 10% glycerol to all buffers

  • Include reducing agents (1-5 mM DTT or 1 mM TCEP)

  • Maintain temperature at 4°C throughout purification

  • Consider adding stabilizing ligands like specific acyl-CoAs

The final product should be assessed for purity by SDS-PAGE (>95%) and activity through binding assays with fatty acyl-CoAs.

How can researchers measure the acyl-CoA binding affinity of recombinant ACBD5?

Several biophysical and biochemical methods can be employed to measure the binding affinity of recombinant bovine ACBD5 to various acyl-CoAs:

Isothermal Titration Calorimetry (ITC):

  • Provides direct measurement of binding affinities, stoichiometry, and thermodynamic parameters

  • Example protocol: Titrate 5-10 μM purified ACBD5 with 50-100 μM acyl-CoA in 20 mM HEPES pH 7.4, 150 mM NaCl at 25°C

  • Analysis yields dissociation constant (Kd), enthalpy (ΔH), and binding stoichiometry

  • Studies with related ACBPs have shown nanomolar affinities to medium and long-chain acyl-CoAs

Fluorescence-based Assays:

  • Intrinsic tryptophan fluorescence quenching upon acyl-CoA binding

  • ANS (8-anilino-1-naphthalenesulfonic acid) displacement assay

  • Procedure: Monitor fluorescence changes of 1 μM ACBD5 with increasing concentrations of acyl-CoAs (0.1-10 μM)

Surface Plasmon Resonance (SPR):

  • Real-time binding kinetics (kon and koff rates)

  • Immobilize ACBD5 on CM5 chip and flow different acyl-CoAs at various concentrations

Acyl-CoA Binding Competition Assay:

  • Incubate purified ACBD5 (1 μM) with radiolabeled acyl-CoA (e.g., [14C]-palmitoyl-CoA, 0.1 μM)

  • Add increasing concentrations of unlabeled acyl-CoAs (0.01-100 μM)

  • Separate bound from free acyl-CoA using equilibrium dialysis or gel filtration

  • Quantify bound radiolabeled acyl-CoA to determine IC50 values

Based on studies with related ACBPs, researchers should expect ACBD5 to show preferential binding to very-long-chain acyl-CoAs with Kd values in the nanomolar range (10-100 nM) .

What cellular assays can be used to investigate ACBD5's role in peroxisomal VLCFA metabolism?

Several cellular assays can be employed to investigate ACBD5's role in peroxisomal VLCFA metabolism:

VLCFA β-oxidation Assay:

  • Culture cells (control vs. ACBD5-deficient) in medium containing [1-14C]-labeled VLCFAs (e.g., C24:0 or C26:0)

  • Collect media and measure 14CO2 production (complete oxidation) and 14C-labeled acid-soluble metabolites (incomplete oxidation)

  • Calculate the sum of both parameters as total β-oxidation

  • Expected result: ACBD5-deficient cells show approximately 70-80% of normal β-oxidation capacity for VLCFAs

Lipidomic Analysis of VLCFA-containing Phospholipids:

  • Extract total lipids from control and ACBD5-deficient cells

  • Perform liquid chromatography-tandem mass spectrometry (LC-MS/MS)

  • Quantify phospholipid species containing VLCFAs

  • Expected result: ACBD5-deficient cells show elevated levels of phosphatidylcholine (PC) and phosphatidylethanolamine (PE) species containing VLCFAs

Fatty Acid Profiling by Gas Chromatography:

  • Extract total lipids from cells or tissues

  • Perform fatty acid methyl ester (FAME) derivatization

  • Analyze by gas chromatography-mass spectrometry (GC-MS)

  • Compare VLCFA (C22:0, C24:0, C26:0) levels between control and ACBD5-deficient samples

  • Expected result: Higher VLCFA levels in ACBD5-deficient samples

Real-time VLCFA Uptake Assay:

  • Load cells with fluorescent VLCFA analogs (e.g., BODIPY-C22)

  • Monitor uptake and peroxisomal localization using live-cell imaging

  • Compare kinetics between wild-type and ACBD5-manipulated cells

Peroxisome-ER Contact Site Quantification:

  • Perform transmission electron microscopy (TEM) on control and ACBD5-deficient cells

  • Measure the frequency and extent of peroxisome-ER contacts

  • Alternative approach: Use split-GFP or FRET-based proximity sensors to quantify contacts in living cells

  • Expected result: Reduced peroxisome-ER contacts in ACBD5-deficient cells

How is ACBD5 deficiency linked to retinal dystrophy and neurological disorders?

ACBD5 deficiency has been identified as the cause of a syndromic form of retinal dystrophy with severe neurological involvement (OMIM #616618), representing a novel peroxisomal disorder . The pathophysiological mechanisms connecting ACBD5 deficiency to these clinical manifestations include:

Primary Biochemical Defects:

  • Impaired peroxisomal β-oxidation of VLCFAs, leading to VLCFA accumulation

  • Altered phospholipid composition, particularly elevated levels of phospholipids containing VLCFAs

  • Potential disruption of peroxisome-ER contact sites, affecting lipid transfer between these organelles

Pathophysiological Consequences in Retina:

  • Retinal cells, particularly photoreceptors, are highly enriched in specialized membrane structures (outer segments) that require precise lipid composition

  • VLCFA accumulation may alter membrane properties and disrupt photoreceptor function

  • Peroxisome dysfunction affects docosahexaenoic acid (DHA) metabolism, which is essential for retinal health

  • Impaired plasmalogens synthesis (another peroxisomal function) may contribute to membrane instability

Neurological Manifestations:

  • White matter abnormalities similar to those observed in X-linked adrenoleukodystrophy

  • Development of spastic paraparesis, a frequent finding in peroxisomal disorders

  • Potential disruption of myelin structure due to altered lipid composition

Clinical Progression:

  • Typically presents in childhood with progressive visual loss

  • Neurological symptoms may develop concurrently or follow retinal symptoms

  • MRI findings often show white matter abnormalities

The identification of ACBD5 deficiency has led to its classification as a novel peroxisomal disorder with a biochemical pattern similar to, but distinct from, X-linked adrenoleukodystrophy, which is caused by mutations in the ABCD1 gene encoding a peroxisomal VLCFA transporter .

What research models are available for studying ACBD5 function in bovine systems?

Several research models are available for studying ACBD5 function in bovine systems, ranging from cell culture to animal models:

In Vitro Models:

  • Bovine Primary Cell Cultures:

    • Primary bovine retinal pigment epithelial (RPE) cells

    • Primary bovine hepatocytes (high peroxisome content)

    • Bovine brain microvascular endothelial cells

  • Immortalized Bovine Cell Lines:

    • MDBK (Madin-Darby Bovine Kidney) cells

    • BT (Bovine Turbinate) cells

    • These can be engineered to overexpress or knock down ACBD5

  • Gene Editing Approaches:

    • CRISPR-Cas9-based knockout or knockin of ACBD5 in bovine cells

    • Protocol: Design guide RNAs targeting conserved regions of bovine ACBD5, transfect with Cas9, and screen for modified clones

    • Targeted mutations can mimic those found in human patients

Ex Vivo Models:

  • Precision-cut liver slices from bovine liver

  • Retinal explant cultures to study ACBD5's role in retinal function

Comparative Approaches:

  • Parallel studies in bovine and human cells to identify species-specific differences

  • Use of established human ACBD5-deficient fibroblasts as comparators

  • Heterologous expression of bovine ACBD5 in human ACBD5-knockout cells to assess functional conservation

Relevant Data for Model Selection:

Model SystemAdvantagesLimitationsKey Applications
MDBK cellsEasy to culture, amenable to genetic manipulationMay not express all relevant interacting proteinsBasic ACBD5 function, localization studies
Primary bovine hepatocytesHigh peroxisome content, relevant metabolic pathwaysLimited lifespan, donor variabilityVLCFA metabolism studies, peroxisome dynamics
Primary bovine retinal cellsDirectly relevant to retinal dystrophyTechnical challenges in isolation and culturePhotoreceptor degeneration mechanisms
CRISPR-modified bovine cellsPrecise genetic control, isogenic comparisonsTime-consuming to generateMechanistic studies, structure-function relationships

These models can help elucidate the specific functions of bovine ACBD5 in different tissues and provide insights into species-specific aspects of ACBD5 biology that may be relevant for both veterinary and comparative medicine.

How does ACBD5 interact with other peroxisomal and ER proteins in the context of organelle tethering?

ACBD5 plays a crucial role in peroxisome-ER tethering through specific protein-protein interactions. The molecular mechanisms and interacting partners include:

ACBD5-VAPB Tethering Complex:

  • ACBD5 contains an FFAT-like motif in its central region that mediates binding to the MSP (major sperm protein) domain of VAPB on the ER membrane

  • This interaction is regulated by phosphorylation of the ACBD5 FFAT-like motif, providing a mechanism for dynamic control of peroxisome-ER contacts

  • Co-expression of ACBD5 and VAPB increases peroxisome-ER contacts, while depletion reduces them

Functional Consequences of ACBD5-mediated Tethering:

  • Facilitation of lipid transfer between the ER and peroxisomes

  • Support of peroxisomal membrane expansion during proliferation

  • Coordination of metabolic functions between the two organelles

Other Potential Interacting Partners:

  • PEX proteins: ACBD5 may interact with components of the peroxisomal import machinery

  • ACBD4: Another ACBD family member that can also form contacts with the ER, potentially with different specificities or regulatory mechanisms

  • Lipid metabolism enzymes: ACBD5 might form functional complexes with enzymes involved in VLCFA metabolism

Experimental Approaches to Study These Interactions:

  • Proximity Labeling Proteomics:

    • Use APEX2 or BioID fused to ACBD5 to identify proximal proteins in intact cells

    • Example: APEX2-mediated biotinylation has identified potential ACBD5 interactors in the context of HCV infection

  • Co-immunoprecipitation Coupled with Mass Spectrometry:

    • Pull down ACBD5 and identify associated proteins

    • Crosslinking approaches can capture transient interactions

  • FRET/BRET-based Interaction Assays:

    • Monitor real-time interactions between ACBD5 and potential partners

    • Allows assessment of interaction dynamics in response to cellular stimuli

  • Structural Studies:

    • X-ray crystallography or cryo-EM of ACBD5 fragments with interacting partners

    • Focus on the FFAT-like motif interaction with VAPB's MSP domain

The identification of these interaction networks provides insight into how ACBD5 functions within a larger protein complex to coordinate peroxisomal functions with other cellular processes.

How can structural biology approaches enhance our understanding of ACBD5 function?

Structural biology approaches offer powerful tools to elucidate the molecular mechanisms underlying ACBD5 function. Several methodologies and their potential applications include:

X-ray Crystallography:

  • Determine high-resolution structures of the ACBD domain bound to various acyl-CoA ligands

  • Identify key residues involved in acyl-CoA binding specificity

  • Map the structural basis for preferential binding to very-long-chain acyl-CoAs

  • Challenges include obtaining crystals of membrane-associated proteins; focus on soluble domains initially

Cryo-Electron Microscopy (Cryo-EM):

  • Visualize full-length ACBD5 in membrane-like environments (nanodiscs or detergent micelles)

  • Study ACBD5 in complex with interacting partners like VAPB

  • Reveal conformational changes upon ligand binding or protein interaction

  • Particularly useful for the membrane-embedded portions difficult to study by crystallography

Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Characterize solution dynamics of ACBD domain

  • Study conformational changes upon ligand binding

  • Identify flexible regions important for function

  • Map interaction interfaces with binding partners

Molecular Dynamics Simulations:

  • Model acyl-CoA binding and release mechanisms

  • Simulate ACBD5 behavior at the peroxisomal membrane interface

  • Predict effects of disease-causing mutations on protein stability and function

  • Integrate experimental structural data with computational approaches

Small-Angle X-ray Scattering (SAXS):

Proximity-based Structural Mapping:

  • Chemical crosslinking coupled with mass spectrometry (XL-MS) to identify spatial relationships

  • Site-directed spin labeling and electron paramagnetic resonance (EPR) to measure distances between specific residues

Potential Research Questions Addressable Through Structural Biology:

  • How does ACBD5 distinguish between different acyl-CoA chain lengths?

  • What conformational changes occur upon acyl-CoA binding?

  • How does the FFAT-like motif interact with VAPB's MSP domain at the molecular level?

  • What is the arrangement of ACBD5 at the peroxisomal membrane?

  • How do disease-causing mutations affect ACBD5 structure and function?

These structural insights would significantly advance our understanding of ACBD5 biology and could inform the development of tools to modulate ACBD5 function in research and potential therapeutic contexts.

What are the implications of ACBD5 research for understanding peroxisomal disorders beyond retinal dystrophy?

Research on ACBD5 has broader implications for understanding various peroxisomal disorders beyond retinal dystrophy, offering insights into fundamental peroxisomal biology and potential therapeutic approaches:

Classification of Peroxisomal Disorders:

  • ACBD5 deficiency represents a novel category of peroxisomal disorders with a unique biochemical signature

  • Understanding ACBD5 function helps refine the classification system of peroxisomal disorders based on molecular mechanisms rather than just clinical presentations

  • This may lead to more precise diagnostic approaches for patients with unclassified peroxisomal dysfunction

Mechanistic Insights into Common Peroxisomal Pathways:

  • ACBD5 research illuminates the critical role of VLCFA metabolism in peroxisomal health

  • Findings may be relevant to other disorders with VLCFA accumulation, such as X-linked adrenoleukodystrophy and Zellweger spectrum disorders

  • The importance of peroxisome-ER contacts revealed through ACBD5 studies has implications for all peroxisomal functions requiring ER cooperation

Novel Biomarkers for Peroxisomal Function:

  • Specific phospholipid species altered in ACBD5 deficiency could serve as biomarkers for peroxisomal dysfunction

  • Patterns of VLCFA accumulation in ACBD5 deficiency may help distinguish it from other peroxisomal disorders

  • These biomarkers could improve diagnosis and monitoring of treatment efficacy

Therapeutic Implications:

  • Dietary Interventions:

    • Insights from ACBD5 research suggest that dietary VLCFA restriction might benefit patients with peroxisomal disorders

    • Oil supplementation strategies might be refined based on understanding ACBD5's role in fatty acid metabolism

  • Pharmacological Approaches:

    • Compounds that enhance residual peroxisomal β-oxidation could benefit multiple peroxisomal disorders

    • Drugs targeting the ACBD5-VAPB interaction might modulate peroxisome-ER contacts for therapeutic benefit

  • Gene and Protein Replacement Strategies:

    • Understanding ACBD5 function informs the development of gene therapy approaches for ACBD5 deficiency

    • These approaches might be adaptable to other single-gene peroxisomal disorders

Comparative Studies and One Health Approach:

  • Research on bovine ACBD5 may reveal species-specific adaptations in peroxisomal function

  • Comparative studies could identify conserved versus divergent aspects of peroxisomal biology

  • This knowledge contributes to a "One Health" approach connecting human, animal, and environmental health

Broader Implications for Cellular Biology:

  • ACBD5 research provides insights into organelle contact site formation and regulation

  • Understanding how ACBD5 deficiency affects cellular lipid homeostasis contributes to knowledge of membrane biology

  • The role of ACBD5 in VLCFA metabolism has implications for understanding the pathogenesis of metabolic diseases associated with lipid dysregulation

This broader perspective positions ACBD5 research as a valuable window into peroxisomal biology with implications extending well beyond the specific syndrome associated with its deficiency.

What are the key knowledge gaps in ACBD5 research that need to be addressed?

Despite significant advances in understanding ACBD5 biology, several critical knowledge gaps remain that require further research:

Structural and Biochemical Aspects:

  • Lack of high-resolution structures for full-length ACBD5 or its domains complexed with acyl-CoAs

  • Incomplete understanding of how ACBD5 selectively binds VLC-CoAs with high affinity

  • Limited information on how post-translational modifications regulate ACBD5 function

  • Unclear mechanisms of how ACBD5 facilitates the transfer of acyl-CoAs to peroxisomal β-oxidation enzymes

Cellular and Molecular Biology:

  • Incomplete characterization of the ACBD5 interactome beyond VAPB

  • Limited understanding of how ACBD5-mediated peroxisome-ER contacts are regulated in response to metabolic changes

  • Unknown role of ACBD5 in peroxisomal membrane dynamics and biogenesis

  • Unclear significance of ACBD5's potential role in pexophagy mentioned in the literature

Physiological and Clinical Aspects:

  • Incomplete understanding of tissue-specific roles of ACBD5, particularly in retina and brain

  • Limited knowledge of how ACBD5 deficiency leads to the specific pattern of retinal dystrophy

  • Unexplored potential roles in other organs and physiological processes

  • Limited natural history data on the progression of ACBD5-related disorders

Species-Specific Knowledge:

  • Minimal comparative data between bovine and human ACBD5 function

  • Unknown significance of ACBD5 in bovine-specific metabolic pathways

  • Limited understanding of potential bovine models of ACBD5 deficiency

Therapeutic Development:

  • No established approaches to rescue ACBD5 function in disease

  • Limited research on whether enhancing peroxisome-ER contacts can compensate for ACBD5 deficiency

  • No targeted interventions for the VLCFA accumulation specific to ACBD5 deficiency

Addressing these knowledge gaps would significantly advance our understanding of ACBD5 biology and could lead to improved diagnostic and therapeutic approaches for ACBD5-related disorders and other peroxisomal diseases.

What are the most promising future research directions for bovine ACBD5 studies?

The study of bovine ACBD5 presents several promising research directions that could significantly advance both basic science understanding and potential applications in animal and human health:

Comparative Molecular Biology:

  • Systematic comparison of bovine and human ACBD5 binding affinities for different acyl-CoA species

  • Identification of species-specific binding partners and regulatory mechanisms

  • Investigation of how evolutionary adaptations in bovine ACBD5 reflect ruminant-specific lipid metabolism

  • Development of bovine-specific antibodies and research tools to facilitate these studies

Agricultural and Veterinary Applications:

  • Exploration of ACBD5's role in bovine lipid metabolism related to milk production

  • Investigation of potential links between ACBD5 function and bovine metabolic disorders

  • Assessment of ACBD5 as a biomarker for metabolic health in cattle

  • Examination of how ACBD5 function impacts bovine reproduction and development

Translational Research Models:

  • Development of bovine cell lines with ACBD5 modifications as research tools

  • Creation of reporter systems to monitor ACBD5 activity in bovine cells

  • Establishment of bovine tissue models to study retinal and neurological manifestations of ACBD5 dysfunction

  • Exploration of species-specific differences in disease phenotypes

Therapeutic Exploration:

  • Testing of compounds that enhance residual ACBD5 function in deficiency models

  • Development of approaches to modulate peroxisome-ER contacts independent of ACBD5

  • Investigation of dietary interventions that might compensate for ACBD5 dysfunction

  • Exploration of gene therapy approaches in bovine models as proof-of-concept

Emerging Technologies Application:

  • Single-cell analysis of ACBD5 expression and function in bovine tissues

  • Application of spatial transcriptomics to understand ACBD5's role in tissue architecture

  • Development of organoid models to study tissue-specific ACBD5 functions

  • Application of advanced imaging techniques to visualize ACBD5-mediated processes in real-time

Integrative Approaches:

  • Multi-omics studies to understand the impact of ACBD5 variation on bovine metabolic networks

  • Systems biology modeling of peroxisomal function with ACBD5 as a key component

  • Ecological and evolutionary studies of ACBD5 adaptations across ruminant species

  • One Health approaches connecting bovine ACBD5 research to broader health concepts

These research directions would not only advance our understanding of bovine biology but could also provide valuable insights into human peroxisomal disorders and fundamental cellular processes involving organelle cooperation and lipid metabolism.

What are the landmark studies in ACBD5 research?

Key landmark studies in ACBD5 research have established its structure, function, and clinical significance:

  • Discovery of ACBD5 as a Peroxisomal Protein (2009-2012)

    • Identification of ACBD5 in peroxisomal proteomics studies

    • Characterization as a membrane-bound protein with an acyl-CoA binding domain

  • Clinical Significance Established (2016)

    • Identification of ACBD5 mutation in patients with retinal dystrophy and neurological involvement

    • Classification as a new peroxisomal disorder (OMIM #616618)

  • Functional Characterization (2016-2017)

    • Demonstration that ACBD5 deficiency causes defects in peroxisomal β-oxidation of VLCFAs

    • Evidence that ACBD5 preferentially binds VLC-CoAs

    • Characterization as a peroxisomal tail-anchored membrane protein

  • Peroxisome-ER Contact Site Role (2017)

    • Discovery of ACBD5's interaction with ER-resident VAPB

    • Demonstration that this interaction mediates peroxisome-ER contacts

    • Characterization of the FFAT-like motif in ACBD5 that mediates VAPB binding

  • Regulatory Mechanisms (2018-2019)

    • Identification of phosphorylation as a regulatory mechanism for ACBD5-VAPB interaction

    • Characterization of ACBD5's role in lipid homeostasis

  • Pathophysiological Insights (2020-2023)

    • Expanded understanding of how ACBD5 deficiency leads to disease

    • Integration of ACBD5 into broader peroxisomal biology frameworks

    • Studies of ACBD5 in various model systems including viral infection models

These landmark studies have collectively established ACBD5 as a critical player in peroxisomal function, lipid metabolism, and organelle communication, with important implications for human and animal health.

What methodological resources are available for researchers studying recombinant bovine ACBD5?

Researchers studying recombinant bovine ACBD5 can access several methodological resources:

Genetic and Sequence Resources:

  • Bovine genome databases containing ACBD5 sequence and variants

  • Comparative genomic tools for aligning bovine ACBD5 with other species

  • Primer design tools optimized for bovine sequences

  • CRISPR guide RNA design platforms with bovine genome integration

Expression Systems and Vectors:

  • Optimized expression vectors for bacterial, mammalian, and insect cell systems

  • Codon-optimized synthetic bovine ACBD5 sequences for heterologous expression

  • Fusion tag systems (His, GST, MBP) compatible with ACBD5 functional studies

  • Inducible expression systems for controlled ACBD5 production

Purification Protocols:

  • Optimized protocols for membrane protein solubilization

  • Affinity chromatography approaches for tagged ACBD5 variants

  • Size exclusion and ion exchange chromatography parameters

  • Quality control methods for assessing purified protein activity

Functional Assay Resources:

  • Protocols for acyl-CoA binding assays (fluorescence-based, ITC, SPR)

  • Standardized β-oxidation assays compatible with bovine systems

  • Lipidomic analysis workflows for detecting VLCFA-containing lipids

  • Microscopy approaches for visualizing peroxisome-ER contacts

Cell Biology Tools:

  • Characterized antibodies against conserved ACBD5 epitopes

  • Fluorescent peroxisomal markers compatible with bovine cells

  • Established bovine cell lines amenable to ACBD5 manipulation

  • Transfection protocols optimized for bovine cells

Data Analysis Resources:

  • Software for analyzing binding kinetics data

  • Bioinformatics tools for sequence analysis and structure prediction

  • Image analysis platforms for quantifying organelle contacts

  • Statistical approaches for analyzing complex lipid metabolism data

Community Resources:

  • Peroxisome research consortia with expertise in ACBD protein biology

  • Biobanks with bovine tissue samples for comparative studies

  • Shared protocols through research networks and publications

  • Collaborative groups focusing on peroxisomal disorders

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.