Recombinant Bovine Acyl-CoA desaturase (SCD)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Functional Insights

Studies on recombinant SCD in bovine mammary epithelial cells (BuMECs) reveal:

Overexpression Effects

ParameterChange (vs. Control)Key Impact
SCD mRNA↑87-fold Enhanced MUFA synthesis
ACACA/FASN expression↑3.43-/↑2.22-fold Increased de novo fatty acid synthesis
Triglyceride (TAG) content↑34% Elevated milk fat production
SREBF1/PPARG↑2.13-/↑2.78-fold Activated lipid regulatory pathways

Knockdown Effects

ParameterChange (vs. Control)Key Impact
SCD mRNA↓92% Impaired desaturation capacity
ACACA/FASN expression↓59%/↓90% Reduced fatty acid synthesis
TAG content↓30% Decreased milk fat yield

Biochemical Role in Lipid Metabolism

SCD catalyzes:
Stearoyl-CoA+NADH+H++O2Oleoyl-CoA+NAD++2H2O\text{Stearoyl-CoA} + \text{NADH} + \text{H}^+ + \text{O}_2 \rightarrow \text{Oleoyl-CoA} + \text{NAD}^+ + 2\text{H}_2\text{O}

  • Primary substrates: Palmitoyl-CoA (C16:0) and stearoyl-CoA (C18:0)

  • Products: Palmitoleoyl-CoA (C16:1) and oleoyl-CoA (C18:1), which constitute >70% of milk MUFAs

  • Downstream effects: Modulates membrane fluidity, lipoprotein assembly, and insulin sensitivity

SNP Associations in Bovine SCD

SNP LocusGenotypeMilk Yield (kg/d)Milk Fat (%)Significance
c.-605A>CAC7.66 ± 0.76 6.48 ± 0.5438.9% ↑ yield vs. AA
c.-603G>AGA5.81 ± 0.38 6.79 ± 0.26Non-significant

Agricultural Relevance

  • Marker-assisted selection: The c.-605A>C SNP serves as a potential marker for enhancing milk production in buffalo .

  • Dietary modulation: High-starch diets upregulate SCD activity in cattle subcutaneous adipose tissue .

Research Challenges and Directions

  • Heterologous expression: Optimizing recombinant SCD yield in bacterial/yeast systems remains technically challenging due to its transmembrane domains .

  • Functional studies: Further in vivo validation is needed to assess off-target effects of SCD overexpression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SCD; Stearoyl-CoA desaturase; Acyl-CoA desaturase; Delta(9-desaturase; Delta-9 desaturase; Fatty acid desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-359
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
SCD
Target Protein Sequence
PAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPTYQD KEGPKPKLEYVWRNIILMSLLHLGALYGITLIPTCKIYTYIWVLFYYLMGALGITAGAHR LWSHRTYKARLPLRVFLIIGNTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFSH VGWLLVRKHPAVKEKGSTLNLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWDET FQNSLFFATLFRYALGLNVTWLVNSAAHMYGYRPYDKTINPRENILVSLGAAGEGFHNYH HTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAILARIKRTGEESYKSG
Uniprot No.

Target Background

Function

Recombinant Bovine Acyl-CoA desaturase (SCD) is a stearoyl-CoA desaturase that utilizes O2 and electrons from reduced cytochrome b5 to introduce a double bond into saturated fatty acyl-CoA substrates. It catalyzes the insertion of a cis double bond at the delta-9 position in substrates like palmitoyl-CoA and stearoyl-CoA, producing a mixture of 16:1 and 18:1 unsaturated fatty acids. This enzyme plays a crucial role in lipid biosynthesis, regulating the expression of lipogenesis-related genes and mitochondrial fatty acid oxidation. It is also important in body energy homeostasis and contributes to the biosynthesis of membrane phospholipids, cholesterol esters, and triglycerides.

Gene References Into Functions
  1. SCD1 expression downregulation occurs via reduced transcription and SREBP1c (sterol regulatory element-binding protein 1) abundance. This is enhanced by chromatin tightening and DNA methylation around the SREBP1c binding site in the SCD1 promoter. PMID: 29274956
  2. SCD1 plays significant roles in growth and lipid metabolism. PMID: 29154485
  3. E. coli mastitis decreases SCD1 expression in the liver and udder. PMID: 27439381
  4. The SCD1 CC genotype is associated with low cholesterolemic fatty acid content, a high linolenic acid to cholesterolemic fatty acid ratio, and lower conjugated-linolenic acid and PUFA content. PMID: 27173340
  5. The SCD gene significantly affects milk medium- and long-chain unsaturated fatty acids, particularly C14:1 and the C14 index in dairy cattle. PMID: 26970560
  6. This study investigated the responsiveness of the bovine SCD1 promoter to serum, insulin, oleic acid, and the NFY transcription factor in BME-UV1 cells. PMID: 26158455
  7. A mutation in SCD1, but not LEPR or ABCG2, may be a useful DNA marker to improve reproductive traits and production in Iranian Holstein dairy cows. PMID: 25130486
  8. Supplemental arginine induces SCD and CEBPB, promoting adiposity in Angus steers. PMID: 24327170
  9. Milk somatic cells provide a non-invasive alternative to mammary biopsies for studying SCD1 expression in dairy cows. PMID: 22369625
  10. Breed and diet influence muscle lipid metabolism, potentially modulated by SCD gene expression levels. PMID: 23467818
  11. This study examined the effects of the A293V polymorphism on milk fat composition in winter and summer. PMID: 23127906
  12. Genetic information on the SREBP1 signaling pathway and SCD can be used for marker-assisted breeding to modify milk fat composition. PMID: 22114848
  13. This study evaluated the impact of FASN and SCD gene polymorphisms on muscle fatty acid composition in two Japanese Black cattle populations. PMID: 22497525
  14. Stearoyl-CoA desaturase SNPs affect milk yield in the Chinese dairy population. PMID: 22722989
  15. SCD and FASN are strong candidate genes influencing fatty acid composition in beef cattle. PMID: 22221030
  16. Stearoyl-CoA desaturase gene expression is higher in heifer adipose tissue and partly associated with adipose tissue fatty acid composition. PMID: 21640489
  17. Adipose tissue fatty acid desaturation, not hepatic or duodenal fatty acids, primarily regulates adipose tissue fatty acid composition. PMID: 21454869
  18. This study investigated the effects of LXR, SCD, FASN, and FABP4 gene polymorphisms on fatty acid composition in steer fat tissue. PMID: 21615833
  19. This study confirms the essential role of SCD1 genes in converting saturated fatty acids into monounsaturated fatty acids. PMID: 21145173
  20. This study describes the diet-induced effects of sustained stearoyl-CoA desaturase upregulation on milk fat synthesis and lipogenic gene networks. PMID: 20607344
  21. This study identified SCD1 and SREBP-1 gene polymorphisms in Fleckvieh cattle and their associations with muscle and subcutaneous fat fatty acid concentrations. PMID: 20374858
  22. SCD1 showed significant association with C14:1 cis-9 and C14:1 cis-9/C14:0, a proxy for mammary gland desaturation activity. PMID: 20105547
  23. This study found no significant effect of SCD1 variants on reproductive traits. PMID: 19841232
  24. SNPs in the 3'UTR of the SCD1 gene may explain variations in milk fat monounsaturated fatty acid content. PMID: 19765166
  25. No polymorphisms were found in the SCD promoter among high and low milk CLA producing cows across various breeds. PMID: 15834635
  26. A transcriptional enhancer element was identified and characterized in the stearoyl-CoA desaturase promoter. PMID: 16603123
  27. This paper describes a second SCD isoform in cattle, an ortholog of human SCD5. PMID: 17468887
  28. The higher desaturase activity of SCD allele C affects myristic and caproleic fatty acid composition in milk. PMID: 17582140
  29. This study reports single nucleotide polymorphisms in the SCD gene open reading frame in Canadian Holstein and Jersey cows. PMID: 17654011
  30. This study indicates an association between the Stearoyl-CoA desaturase (SCD) locus and milk fatty acid profile in Italian Holsteins. PMID: 17699067
  31. SCD mRNA levels were significantly increased in cultured adipocytes from Japanese Black and Holstein cattle, potentially reflecting breed differences in fat development. PMID: 17851104
  32. This study examines the direct influence of SCD polymorphism on milk and beef fatty acid composition. PMID: 18254828
  33. Selective breeding can increase unsaturation indices using SCD1 and DGAT1 polymorphism information. PMID: 18420645
  34. This study explores the potential use of the SCD locus in gene-assisted selection for dairy cattle milk production traits. PMID: 18650296
  35. Monounsaturated fatty acid production is linked to Delta(9)-desaturase activity. PMID: 18650299
  36. The SCD1 gene is a key player in skeletal muscle fat metabolism. PMID: 18825276
Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of recombinant bovine SCD?

Bovine Stearoyl-CoA desaturase (SCD) is a membrane-bound enzyme with several key structural features:

  • It contains an open reading frame of approximately 1080 bp, encoding a protein of 359 amino acids

  • The protein is characterized as unstable and hydrophilic, with an instability index of approximately 47.21

  • It lacks a signal peptide but contains four transmembrane domains (TMhelix1: AA71–93, TMhelix2: AA98–120, TMhelix3: AA221–238, TMhelix4: AA251–273)

  • The protein has both N- and C-terminals facing the cytoplasm

  • It is anchored to the endoplasmic reticulum (ER) membrane via its transmembrane domains

  • SCD contains three catalytically essential and conserved His-box motifs that maintain the functional integrity of the enzyme

  • It is a non-heme Fe-containing enzyme that requires NADH, cytochrome b5, and cytochrome b5 reductase for electron transport during catalysis

These structural features are highly conserved among SCD proteins from various Bovidae species, indicating their functional importance in catalytic activity.

What are the primary substrates and products of bovine SCD?

Bovine SCD catalyzes the introduction of the first double bond into saturated fatty acyl-CoA substrates in both a regio- and stereospecific manner. The enzyme's catalytic activity includes:

  • Primary substrates: Palmitoyl-CoA (C16:0) and stearoyl-CoA (C18:0)

  • Primary products: Palmitoleoyl-CoA (C16:1) and oleoyl-CoA (C18:1), respectively

  • The desaturation occurs specifically between carbons 9 and 10 of the fatty acyl chain in a cis configuration

  • The reaction requires molecular oxygen, NADH, and an electron transport system involving cytochrome b5 and cytochrome b5 reductase

This enzymatic conversion is a critical step in the biosynthesis of monounsaturated fatty acids (MUFAs) from saturated fatty acids (SFAs) in bovine tissues, particularly in mammary glands during lactation.

What post-translational modifications are present in bovine SCD?

Bovine SCD undergoes several post-translational modifications that influence its function and regulation:

  • Six potential functional modification sites have been identified in buffalo SCD, which are likely similar in bovine SCD :

    • Casein kinase II phosphorylation sites (AA58–61, 164–167, 166–169, 309–312, 351–354)

    • Protein kinase C phosphorylation sites (AA95–97, 124–126, 127–129, 173–175, 355–357)

    • N-myristoylation sites (AA85–90, 114–119, 141–146, 197–202, 257–262)

    • N-glycosylation sites (AA201–204, 259–262, 318–321)

    • cAMP- and cGMP-dependent protein kinase phosphorylation sites (AA337–340)

    • Tyrosine kinase phosphorylation site 2 (AA349–356)

These post-translational modifications are important for regulating SCD activity, membrane localization, and protein-protein interactions in cellular pathways involved in lipid metabolism.

How does SCD expression vary across bovine tissues?

Studies on buffalo SCD, which shares high similarity with bovine SCD, have revealed distinct tissue-specific expression patterns:

  • Highest expression is observed in the mammary gland during lactation, suggesting a critical role in milk fat synthesis

  • In non-lactating animals, the cerebellum shows relatively high expression levels

  • Expression in the mammary gland is significantly higher during lactation compared to the dry-off period, indicating hormonal regulation related to lactation status

  • Other tissues show variable but generally lower expression levels compared to mammary tissue during lactation

This differential expression pattern reflects the tissue-specific functions of SCD, particularly its role in milk fat synthesis in the mammary gland and its involvement in maintaining membrane lipid composition in other tissues.

What factors regulate SCD gene expression in bovine tissues?

Several factors have been identified that regulate SCD expression in bovine tissues:

  • Transcription factors:

    • Sterol regulatory element-binding transcription factors (SREBFs) directly regulate SCD expression

    • Peroxisome proliferator-activated receptor gamma (PPARG) is involved in SCD regulation

    • SP1 transcription factor contributes to SCD expression regulation

    • Insulin-induced gene 1 (INSIG1) appears to have a negative regulatory effect on SCD expression

  • Signaling pathways:

    • AMP-activated protein kinase (AMPK)/mammalian target of rapamycin (mTOR) pathway enhances SCD expression

    • Phosphoinositide 3-kinase (PI3K)/protein kinase B (PKB) signaling pathway positively regulates SCD expression

  • Physiological states:

    • Lactation significantly increases SCD expression in mammary tissue

    • Nutritional status affects SCD expression through substrate availability and hormonal changes

Understanding these regulatory mechanisms provides insights into potential strategies for modulating SCD expression in research settings.

What expression systems are most effective for producing recombinant bovine SCD?

The choice of expression system for recombinant bovine SCD depends on research objectives:

  • Mammalian cell systems:

    • Buffalo mammary epithelial cells (BuMECs) have been successfully used for functional studies of SCD

    • HEK293 cells provide proper post-translational modifications and membrane integration

    • Chinese hamster ovary (CHO) cells are suitable for large-scale production

  • Insect cell systems:

    • Sf9 or High Five™ cells using baculovirus expression systems can yield functional membrane proteins

    • Provide better folding and post-translational modifications than bacterial systems

  • Yeast expression systems:

    • Pichia pastoris or Saccharomyces cerevisiae can be used for membrane protein expression

    • Allow proper protein folding and some post-translational modifications

For experimental purposes, the pEGFP-N1 vector has been successfully used for SCD overexpression in mammary epithelial cells, allowing for both functional studies and visualization of protein localization .

What purification strategies yield the highest activity for recombinant bovine SCD?

Purification of recombinant bovine SCD requires specialized approaches due to its membrane-bound nature:

  • Membrane fraction isolation:

    • Differential centrifugation to isolate ER membranes containing SCD

    • Sucrose gradient ultracentrifugation for membrane fraction enrichment

  • Solubilization strategies:

    • Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin preserve activity

    • Detergent screening is crucial to identify optimal solubilization conditions

  • Affinity purification:

    • His-tag purification using Ni-NTA resins is commonly employed

    • Anti-FLAG or other epitope tags may be used for improved purity

  • Size exclusion chromatography:

    • Further purification to obtain homogeneous protein preparations

    • Assessment of protein oligomeric state

  • Activity preservation:

    • Addition of glycerol (10-20%) to stabilize the enzyme

    • Inclusion of reducing agents (DTT or β-mercaptoethanol)

    • Presence of phospholipids or lipid nanodiscs to maintain native-like environment

Careful optimization of each purification step is essential to maintain the catalytic activity of bovine SCD, as the enzyme is sensitive to detergent concentration, oxidation, and loss of essential cofactors.

How can SCD enzymatic activity be measured in vitro?

Several methods can be employed to measure SCD activity in vitro:

  • Radioisotope-based assays:

    • Incubation of purified SCD with [14C]-labeled substrates (palmitoyl-CoA or stearoyl-CoA)

    • Separation of products by thin-layer chromatography or HPLC

    • Quantification of conversion rates by scintillation counting

  • HPLC/GC-MS analysis:

    • Reaction of SCD with unlabeled substrates

    • Derivatization of fatty acid products

    • Separation and quantification by HPLC or GC-MS

    • Ratio of monounsaturated to saturated fatty acids determines activity

  • Oxygen consumption assays:

    • SCD requires molecular oxygen for desaturation

    • Measurement of oxygen consumption rates using oxygen electrodes

    • Real-time monitoring of enzymatic activity

  • Spectrophotometric assays:

    • Coupled enzyme assays monitoring NADH oxidation at 340 nm

    • Continuous monitoring of reaction progress

When assessing activity, it's essential to include appropriate controls and to consider the influence of detergents, lipid environment, and the presence of the complete electron transport system (cytochrome b5 and cytochrome b5 reductase) on SCD function.

What cellular models are appropriate for studying bovine SCD function?

Several cellular models are suitable for studying bovine SCD function:

  • Primary bovine mammary epithelial cells (BMECs):

    • Closest to physiological conditions

    • Express endogenous enzymes involved in fatty acid metabolism

    • Limited availability and passage number

  • Immortalized bovine mammary epithelial cell lines:

    • MAC-T cells (bovine mammary alveolar cells)

    • Maintain many characteristics of primary cells

    • Suitable for long-term studies and genetic manipulation

  • Buffalo mammary epithelial cells (BuMECs):

    • Have been successfully used for SCD functional studies

    • Allow overexpression and knockdown experiments

    • Support assessment of effects on lipid synthesis pathways

  • Heterologous expression systems:

    • HEK293, CHO, or other mammalian cells for specific mechanistic studies

    • Allow controlled expression of wild-type or mutant SCD variants

  • Experimental approaches:

    • Overexpression using vectors like pEGFP-N1-SCD

    • RNA interference for knockdown studies

    • CRISPR/Cas9 for genome editing and generation of knockout models

These cellular models can be used to study the effects of SCD on:

  • Gene expression of other lipid metabolism factors

  • Intracellular lipid accumulation and composition

  • Response to hormonal and nutritional factors

  • Subcellular localization using fluorescent protein tags

What molecular techniques effectively assess SCD functions in bovine mammary cells?

Several molecular techniques can effectively assess SCD functions in bovine mammary cells:

  • Gene expression analysis:

    • Quantitative real-time PCR (qPCR) to measure mRNA levels of SCD and related genes

    • RNA sequencing for global transcriptome analysis

    • Northern blotting for specific transcript variants

  • Protein analysis:

    • Western blotting for protein expression levels

    • Immunofluorescence for subcellular localization

    • Co-immunoprecipitation for protein-protein interactions

  • Genetic manipulation:

    • Overexpression experiments using vectors like pEGFP-N1-SCD

    • siRNA or shRNA for knockdown studies

    • CRISPR/Cas9 for targeted gene editing

  • Lipid analysis:

    • Triglyceride (TAG) content measurement using commercial kits

    • Fatty acid profiling by gas chromatography

    • Lipid droplet visualization using Oil Red O or BODIPY staining

  • Functional readouts:

    • Analysis of downstream gene expression (e.g., ACACA, FASN, DGAT1)

    • Assessment of regulatory factors (SREBFs, PPARG, SP1, INSIG1)

    • Measurement of cellular triglyceride content as an indicator of milk fat synthesis

For example, in buffalo mammary epithelial cells, SCD overexpression led to:

  • ~87-fold increase in SCD mRNA levels

  • Increased expression of ACACA (~3.43-fold), FASN (~2.22-fold), and DGAT1 (~2.74-fold)

  • Decreased CD36 expression (85% reduction)

  • Increased expression of regulatory genes SREBF1 (~2.13-fold), SREBF2 (~3.68-fold), and PPARG (~2.78-fold)

  • ~1.34-fold increase in cellular TAG content

These techniques provide comprehensive insights into SCD function in mammary cells and its role in milk fat synthesis pathways.

How does SCD contribute to milk fat synthesis in bovine mammary glands?

SCD plays a critical role in bovine milk fat synthesis through several mechanisms:

  • De novo fatty acid synthesis pathway:

    • SCD is a key enzyme in the pathway that synthesizes milk fatty acids

    • It converts saturated fatty acids (primarily palmitic acid, C16:0) produced by ACACA and FASN into monounsaturated forms

    • This desaturation step is crucial for maintaining proper milk fat fluidity and composition

  • Regulatory network:

    • SCD influences the expression of other key enzymes in the milk fat synthesis pathway:

      • Acetyl-CoA carboxylase (ACACA): initiates fatty acid synthesis

      • Fatty acid synthase (FASN): elongates fatty acid chains

      • Diacylglycerol O-acyltransferase 1 (DGAT1): catalyzes the final step in triglyceride formation

  • Feedback regulation:

    • SCD activity reduces palmitic acid levels, potentially alleviating the inhibitory effect of palmitoyl-CoA on ACACA

    • This creates a positive feedback loop enhancing fatty acid synthesis

  • Triglyceride formation:

    • Desaturated fatty acids produced by SCD are incorporated into triglycerides (TAGs)

    • SCD overexpression significantly increases TAG content in mammary epithelial cells

  • Transcriptional regulation:

    • SCD affects expression of transcription factors that regulate milk fat synthesis, including:

      • Sterol regulatory element-binding transcription factors (SREBFs)

      • Peroxisome proliferator-activated receptor gamma (PPARG)

      • SP1 transcription factor

The central position of SCD in these pathways makes it a critical regulator of both the quantity and composition of milk fat in bovine species.

What regulatory pathways control SCD expression during lactation?

SCD expression during lactation is controlled by multiple regulatory pathways:

  • Transcription factor networks:

    • SREBFs (particularly SREBF1) bind to sterol regulatory elements in the SCD promoter

    • PPARG activates SCD transcription in response to specific fatty acid ligands

    • SP1 binds to GC-rich regions in the SCD promoter and enhances transcription

    • INSIG1 negatively regulates SCD expression, potentially by inhibiting SREBF activation

  • Signaling cascades:

    • AMP-activated protein kinase (AMPK)/mammalian target of rapamycin (mTOR) pathway:

      • Responds to cellular energy status

      • Enhances SCD expression under appropriate conditions

    • Phosphoinositide 3-kinase (PI3K)/protein kinase B (PKB) signaling:

      • Responds to insulin and other growth factors

      • Positively regulates SCD expression

  • Hormonal regulation:

    • Prolactin, insulin, and glucocorticoids increase SCD expression during lactation

    • These hormones act partly through the SREBF and PPARG pathways

  • Nutritional regulation:

    • Dietary factors influence SCD expression through multiple mechanisms

    • High-carbohydrate diets typically increase SCD expression

    • Polyunsaturated fatty acids (PUFAs) generally suppress SCD expression

  • Developmental regulation:

    • SCD expression in mammary tissue is significantly higher during lactation compared to the dry-off period

    • This pattern matches the increased demand for milk fat synthesis during lactation

Understanding these regulatory pathways provides potential targets for modulating milk fat production and composition in research and agricultural applications.

What SNPs in the bovine SCD gene affect enzyme function or expression?

Several single nucleotide polymorphisms (SNPs) in the bovine SCD gene have been identified that affect enzyme function or expression:

  • Promoter region SNPs:

    • The c.-605A>C polymorphism has been associated with milk yield in buffalo

    • This SNP likely affects transcription factor binding and gene expression levels

  • Coding region SNPs:

    • Three SNPs (c.108, c.149, and c.239) have been identified as specific loci that differentiate buffalo from other Bovidae species

    • These polymorphisms may affect protein structure, stability, or function

  • Functional consequences:

    • Some SNPs alter amino acid sequences, potentially affecting:

      • Protein folding and stability

      • Substrate binding affinity

      • Catalytic efficiency

      • Membrane integration

    • Other SNPs in non-coding regions may influence:

      • Transcription factor binding

      • mRNA stability

      • Alternative splicing

      • Post-transcriptional regulation

These genetic variations contribute to individual differences in milk production traits and fatty acid composition among animals within the same species.

How can SCD polymorphisms be used as markers for dairy trait selection?

SCD polymorphisms can serve as valuable molecular markers for dairy trait selection:

  • Association with production traits:

    • The c.-605A>C SNP in the buffalo SCD gene has shown potential as a marker for improved milk production traits

    • Similar SNPs in bovine SCD may correlate with milk yield, fat content, or fatty acid composition

  • Marker-assisted selection (MAS) approaches:

    • Genotyping breeding stock for favorable SCD alleles

    • Selection of animals carrying desirable variants

    • Integration into breeding programs for genetic improvement

  • Implementation strategies:

    • PCR-RFLP (restriction fragment length polymorphism) for specific SNP detection

    • High-throughput SNP arrays for multiple marker screening

    • Whole-genome sequencing for comprehensive genetic evaluation

  • Practical considerations:

    • Need for validation in different breeds and populations

    • Assessment of interactions with other genetic factors

    • Evaluation of environmental influences on marker effectiveness

  • Benefits of SCD-based selection:

    • Improved milk fat content and composition

    • Enhanced nutritional quality of milk

    • Potential economic benefits for dairy production

Using SCD polymorphisms as molecular markers offers a targeted approach to improving dairy traits through selective breeding, complementing traditional selection methods based on phenotypic evaluation.

How does bovine SCD compare structurally and functionally to SCDs from other species?

Comparative analysis of SCD across species reveals both conservation and divergence:

  • Structural similarities across Bovidae species:

    • Buffalo SCD shares high similarity with other Bovidae species in terms of physicochemical properties, conserved domains, structures, and functions

    • The basic protein architecture with four transmembrane domains is preserved

    • Three catalytically essential His-box motifs are highly conserved

  • Functional conservation:

    • The fundamental catalytic mechanism for desaturating fatty acids at the Δ9 position is conserved

    • Requirement for electron transport components (cytochrome b5, cytochrome b5 reductase, NADH) is consistent

    • Localization to the endoplasmic reticulum is maintained across species

  • Evolutionary aspects:

    • The ACBP family (which includes SCDs) shows diversification as land plants evolved

    • Lineage-specific gene expansions have occurred in Classes I and IV

    • Classes II and III are closely related phylogenetically

  • Species-specific variations:

    • Differences in substrate preferences and catalytic efficiencies

    • Variations in regulatory mechanisms and expression patterns

    • Species-specific post-translational modifications

These comparative insights help understand the evolutionary conservation of essential SCD functions while highlighting adaptations that may relate to species-specific metabolic requirements.

What can be learned from phylogenetic analysis of SCD across species?

Phylogenetic analysis of SCD across species provides valuable insights:

  • Evolutionary conservation:

    • High conservation of key structural and functional domains suggests essential roles in lipid metabolism

    • The presence of SCD homologs across diverse species indicates an early evolutionary origin

  • Structural insights:

    • Conserved regions likely correspond to catalytically critical domains

    • Variable regions may reflect adaptation to species-specific requirements

    • Identification of three key SNPs (c.108, c.149, and c.239) that can differentiate buffalo from other Bovidae species demonstrates the utility of phylogenetic analysis

  • Functional divergence:

    • Species-specific variations may relate to differences in:

      • Diet and environmental adaptation

      • Metabolic requirements

      • Tissue-specific expression patterns

      • Regulatory mechanisms

  • Methodological approaches:

    • Multiple sequence alignment of SCD proteins from diverse species

    • Construction of phylogenetic trees using maximum likelihood or Bayesian methods

    • Analysis of selection pressure on different protein domains

    • Correlation of sequence variations with functional differences

  • Applications:

    • Prediction of functionally important residues based on evolutionary conservation

    • Identification of species-specific adaptations for targeted studies

    • Design of species-specific inhibitors or activators

    • Development of molecular markers for species identification

Phylogenetic analysis thus serves as a powerful tool for understanding the evolution of SCD and identifying key structural and functional elements that can inform experimental design and interpretation.

How can recombinant bovine SCD be used in lipid metabolism research?

Recombinant bovine SCD offers numerous applications in lipid metabolism research:

  • Mechanistic studies:

    • Investigation of enzyme kinetics using purified recombinant SCD

    • Structure-function analysis through site-directed mutagenesis

    • Identification of novel regulatory mechanisms and interaction partners

  • Pathway analysis:

    • Overexpression or knockdown in cellular models to study effects on:

      • De novo fatty acid synthesis pathways

      • Triglyceride formation and accumulation

      • Gene expression networks regulating lipid metabolism

  • Regulatory network mapping:

    • Analysis of how SCD influences and is influenced by:

      • Transcription factors (SREBFs, PPARG, SP1)

      • Signaling pathways (AMPK/mTOR, PI3K/PKB)

      • Metabolic sensors and feedback mechanisms

  • Physiological models:

    • Development of transgenic models with modified SCD expression

    • Study of SCD's role in health and disease states

    • Investigation of tissue-specific effects

  • Tool development:

    • Generation of specific antibodies for detection and localization studies

    • Development of activity-based probes for monitoring SCD function

    • Creation of inhibitors or activators for targeted modulation

These applications contribute to our understanding of lipid metabolism in normal physiology and potential interventions in metabolic disorders.

What are the challenges in expressing and working with recombinant bovine SCD?

Working with recombinant bovine SCD presents several technical challenges:

  • Expression challenges:

    • Membrane protein nature complicates heterologous expression

    • Potential toxicity to host cells when overexpressed

    • Requirements for proper folding and membrane integration

    • Need for co-expression of accessory proteins (cytochrome b5, cytochrome b5 reductase)

  • Purification difficulties:

    • Maintenance of structural integrity during solubilization

    • Selection of appropriate detergents that preserve activity

    • Retention of essential cofactors during purification

    • Prevention of aggregation and precipitation

  • Activity preservation:

    • Sensitivity to oxidation due to iron in the active site

    • Requirements for reducing environment

    • Need for appropriate lipid environment to maintain native conformation

    • Dependence on electron transport components for activity

  • Analytical limitations:

    • Complex activity assays requiring specialized equipment

    • Difficulty in obtaining crystal structures for structural analysis

    • Limited stability under experimental conditions

    • Variability in activity measurements

  • Functional assessment complexities:

    • Multi-factorial regulation in cellular contexts

    • Redundancy with other desaturases in some systems

    • Feedback mechanisms affecting expression and activity

    • Species-specific differences affecting translational relevance

Addressing these challenges requires specialized approaches and careful optimization of experimental conditions to obtain reliable and physiologically relevant results.

How can CRISPR/Cas9 technology be applied to study bovine SCD function?

CRISPR/Cas9 technology offers powerful approaches for studying bovine SCD function:

  • Gene knockout strategies:

    • Complete elimination of SCD expression to determine essential functions

    • Analysis of compensatory mechanisms and redundancy with other desaturases

    • Assessment of metabolic consequences in cellular models

  • Knockin approaches:

    • Introduction of specific mutations to study structure-function relationships

    • Insertion of reporter tags (GFP, luciferase) for localization and expression studies

    • Creation of conditional expression systems for temporal control

  • Promoter modification:

    • Targeted alteration of regulatory elements to understand transcriptional control

    • Introduction or removal of specific transcription factor binding sites

    • Analysis of SNP effects by creating isogenic cell lines differing only at the SNP position

  • Base editing applications:

    • Precise modification of specific nucleotides without double-strand breaks

    • Creation of known polymorphisms to study their functional effects

    • Correction of mutations to restore normal function

  • Methodological considerations:

    • Design of specific guide RNAs targeting bovine SCD

    • Selection of appropriate cell models (primary BMECs, immortalized cell lines)

    • Verification of editing efficiency and specificity

    • Phenotypic characterization using functional assays

CRISPR/Cas9 technology thus provides unprecedented precision in manipulating the bovine SCD gene to answer fundamental questions about its function and regulation, potentially leading to novel strategies for modulating milk fat production and composition.

What emerging technologies might advance our understanding of bovine SCD?

Several emerging technologies hold promise for advancing our understanding of bovine SCD:

  • Cryo-electron microscopy (Cryo-EM):

    • Determination of high-resolution structures of SCD in membrane environments

    • Visualization of conformational changes during catalysis

    • Analysis of interaction with electron transport components

  • Single-cell technologies:

    • Single-cell RNA sequencing to analyze cell-specific expression patterns

    • Spatial transcriptomics to map SCD expression within tissue architecture

    • Single-cell proteomics for protein-level analysis

  • Protein engineering approaches:

    • Directed evolution to enhance stability or activity

    • Creation of biosensors for real-time monitoring of SCD activity

    • Design of switchable variants for controlled activation

  • Advanced imaging techniques:

    • Super-resolution microscopy for subcellular localization studies

    • Live cell imaging to track dynamics and interactions

    • Label-free imaging methods for non-invasive monitoring

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and lipidomics

    • Network analysis to position SCD within global metabolic networks

    • Computational modeling of SCD's role in lipid metabolism

These technologies will provide deeper insights into SCD structure, function, and regulation, potentially leading to novel applications in agricultural and biomedical research.

What are the potential implications of SCD research for dairy production?

SCD research has several potential implications for dairy production:

  • Genetic improvement strategies:

    • Identification of favorable SCD polymorphisms for marker-assisted selection

    • Development of genetic tests for breeding program implementation

    • Creation of gene-edited livestock with optimized SCD expression or activity

  • Nutritional interventions:

    • Design of feeding strategies to modulate SCD expression and activity

    • Formulation of diets that enhance beneficial fatty acid profiles

    • Development of feed additives targeting SCD regulation

  • Production trait enhancement:

    • Improvement of milk fat content and composition

    • Modulation of fatty acid profiles for enhanced nutritional value

    • Potential increases in milk yield through optimized lipid metabolism

  • Product quality improvement:

    • Enhanced processing characteristics of milk

    • Improved organoleptic properties of dairy products

    • Extended shelf life through optimized fatty acid composition

  • Sustainability considerations:

    • Improved feed efficiency through optimized lipid metabolism

    • Reduced environmental impact per unit of production

    • Enhanced animal health through balanced fatty acid profiles

These applications highlight the potential for translating basic SCD research into practical strategies for improving dairy production efficiency, product quality, and sustainability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.