Recombinant Bovine Adenosine receptor A2b (ADORA2B)

Shipped with Ice Packs
In Stock

Description

ADORA2B Overview

Adenosine receptor A2b (ADORA2B) is a G protein-coupled receptor (GPCR) that binds extracellular adenosine, a purine nucleoside critical for modulating inflammation, pain, hypoxia responses, and cell proliferation . Unlike other adenosine receptors (e.g., A1, A2A, A3), ADORA2B has a lower affinity for adenosine and is activated under conditions of elevated adenosine, such as hypoxia or tissue injury .

3.1. Inflammatory and Immune Modulation

  • Anti-inflammatory Role: ADORA2B activation enhances regulatory T cell (Treg) differentiation, limiting inflammation in murine models .

  • Pro-inflammatory Role: In chronic pain models (e.g., sickle cell disease), sustained ADORA2B activation on myeloid cells increases IL-6/STAT3 signaling, sensitizing nociceptors via TRPV1 upregulation .

3.2. Cancer and Drug Resistance

  • Ovarian Cancer: ADORA2B overexpression correlates with PARP inhibitor (Olaparib) resistance. Signaling through IL-6/STAT3 promotes tumor survival and migration .

  • Therapeutic Target: Pharmacological inhibition of ADORA2B (e.g., MRS1754) reduces adenosine-induced sphingosine kinase 1 (SphK1) activity in erythrocytes, relevant to sickle cell disease .

3.3. Cardiovascular and Metabolic Effects

  • Cardioprotection: Gi coupling of ADORA2B mediates protective roles in ischemia-reperfusion injury .

  • Hypoxia Adaptation: ADORA2B activation under low oxygen promotes erythrocyte SphK1 activity, influencing vascular tone .

Pharmacological Tools and Ligands

CompoundActionSpecificityObserved Effect
BAY60-6583AgonistADORA2BEnhances Treg differentiation in mice ; fails to activate TRPV1 in DRG neurons .
MRS1754AntagonistADORA2BBlocks adenosine-induced SphK1 activity in erythrocytes .
NECANonselective agonistAll adenosine receptorsInduces ERK1/2 phosphorylation via Gs/Gi in HEK293 cells .

Research Gaps and Limitations

  • Species-Specific Data: No studies on bovine ADORA2B were identified. Existing insights derive from human, murine, and cell line models.

  • Signaling Complexity: ADORA2B’s G protein coupling varies by cell type, complicating therapeutic targeting .

  • Dual Roles: Context-dependent pro- or anti-inflammatory effects (e.g., Treg vs. Th17 bias) necessitate cell-specific investigation .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for accurate delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, liquid form exhibits a shelf life of 6 months at -20°C/-80°C. Lyophilized form, on the other hand, has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
ADORA2B; Adenosine receptor A2b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MPLEAQDAVYVALELALAALSVTGNVLVCAAVGTSSALQTPTNYFLVSLAAADVAVGLFA IPFAVTISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAVRVPLRYKSLVTGA RARGVIAALWVLAFGIGLTPFLGWNDRKIATNCTEPGDAATNVSCCLIRCLFENVVPMSY MVYFNFFGCVLPPLLIMLVIYVKIFLVACRQLQRTELMDHSRTVLQREIHAAKSLALIVG IFALCWLPVHTINCASLFQPTWAKVKPKWAINTAILLSHANSAVNPIVYAYRNRDFRYTF HKIISRYILCRTHILKSGEGQVGSQPTLQLGL
Uniprot No.

Target Background

Function
Adenosine receptor A2b (ADORA2B) functions as a receptor for adenosine. Its activity is mediated by G proteins, which subsequently activate adenylyl cyclase.
Gene References Into Functions
  1. Purinergic stimulation of cilia beat frequency requires A(2B) adenosine receptor activation, likely via a protein kinase A-dependent pathway. PMID: 21622845
  2. It is likely that adenosine acts through A(2B) receptors and adenylyl cyclases to stimulate CNGA2. PMID: 18292397
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the adenosine A2B receptor (ADORA2B) and what are its primary functions?

ADORA2B is a G-protein coupled adenosine receptor encoded by the ADORA2B gene. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine, leading to increased intracellular cAMP levels . The ADORA2B receptor serves several critical physiological functions:

  • Anti-inflammatory signaling: ADORA2B plays a potent anti-inflammatory role by enhancing regulatory T cell (Treg) abundance and limiting inflammation .

  • Vasodilation regulation: The receptor has been implicated in mediating vasodilation in vascular tissues .

  • Metabolic control: ADORA2B signaling is involved in glucose mobilization and disposal, with its disruption leading to metabolic alterations .

  • Cell growth regulation: The receptor has demonstrated inhibitory effects on the growth of vascular smooth muscle cells .

In experimental settings, ADORA2B function can be investigated using specific agonists such as BAY 60-6583, which produces dose-dependent effects including cAMP accumulation and glucose mobilization that are absent in ADORA2B-deficient models .

How does bovine ADORA2B compare structurally to human and other mammalian species?

While the search results don't provide specific structural comparisons between bovine and human ADORA2B, available recombinant proteins allow for comparative studies. Recombinant bovine ADORA2B is available from expression systems including E. coli (full length and partial proteins) . Similar recombinant options exist for rabbit, mouse, and human ADORA2B, enabling cross-species comparison studies .

The conservation of ADORA2B across mammalian species suggests functional importance, though species-specific differences may exist in receptor pharmacology, tissue distribution, and signaling mechanisms. When designing experiments with bovine ADORA2B, researchers should consider:

  • Amino acid sequence homology compared to human ADORA2B

  • Potential differences in ligand binding affinity

  • Species-specific post-translational modifications

  • Variations in expression patterns across tissues

What expression systems are available for producing recombinant bovine ADORA2B?

Multiple expression systems are available for producing recombinant bovine ADORA2B, each with distinct advantages for different experimental applications:

Expression SystemProduct CodeCharacteristicsBest Applications
E. coli (in vitro)CSB-CF636892BOFull-length proteinStructural studies, antibody generation
YeastCSB-YP636892BO1Partial proteinPost-translational modifications, folding studies
E. coliCSB-EP636892BO1Partial proteinHigh-yield protein production
BaculovirusCSB-BP636892BO1Partial proteinFunctional studies requiring insect cell modifications
Mammalian cellCSB-MP636892BO1Partial proteinSignaling studies, closest to native modification patterns
Biotinylated E. coliCSB-EP636892BO1-BPartial proteinProtein interaction studies, pull-down assays

The choice of expression system should align with research goals. For instance, if studying protein-protein interactions, biotinylated protein from E. coli might be optimal, while for functional signaling studies, mammalian cell-expressed protein may better preserve native receptor characteristics .

How can researchers validate ADORA2B function in experimental models?

Functional validation of ADORA2B activity can be performed through several complementary approaches:

  • cAMP accumulation assay: Since ADORA2B activation stimulates adenylate cyclase, measuring intracellular cAMP levels provides direct evidence of receptor functionality. Adenosine or the specific A2B receptor agonist BAY 60-6583 induce dose-dependent cAMP accumulation that can be quantified .

  • Antagonist inhibition studies: Selective A2B antagonists like PSB-1115 can suppress adenosine-produced cAMP elevation with measurable IC50 values (reported as 84.0 nM in certain cell lines) .

  • Cytokine release measurement: ADORA2B activation influences cytokine production, particularly interleukin-6 (IL-6). Measuring changes in cytokine release following receptor stimulation provides functional validation .

  • Glucose mobilization: BAY 60-6583 produces dose-dependent increases in glucose mobilization that are absent in ADORA2B-deficient models, making this a useful functional readout .

When validating bovine ADORA2B specifically, researchers should establish dose-response curves with known agonists and verify receptor-specific effects through antagonist competition or genetic knockout controls.

How does ADORA2B signaling influence regulatory T cell function?

ADORA2B plays a critical role in enhancing regulatory T cell (Treg) abundance, contributing to its anti-inflammatory function. Research has demonstrated that:

  • ADORA2B receptor engagement enhances Treg abundance during inflammation .

  • In ADORA2B-deficient mice, Treg induction fails after endotoxin-induced inflammation, with enhanced recruitment of pro-inflammatory effector T cells instead .

  • The mechanism involves adenosine receptor-mediated control of cytokine production affecting Treg differentiation and function .

This relationship is particularly evident during pulmonary inflammation, where ADORA2B knockout results in more severe inflammation characterized by increased cell recruitment and fluid leakage into airways . Methodologically, researchers investigating this relationship should:

  • Compare Treg populations (using flow cytometry for markers like CD4+CD25+FoxP3+) between wild-type and ADORA2B-deficient models

  • Assess Treg suppressive function in co-culture assays with effector T cells

  • Measure inflammatory markers in tissues when ADORA2B signaling is modulated

  • Evaluate adenosine-mediated effects on Treg differentiation from naïve CD4+ T cells

What is the role of ADORA2B in acute versus chronic inflammatory states?

ADORA2B exhibits contrasting roles in acute versus chronic inflammatory conditions, representing a complex temporal dynamic:

In acute inflammation:

  • ADORA2B signaling is predominantly protective and anti-inflammatory

  • It suppresses tissue inflammation by enhancing Treg function

  • ADORA2B-deficient models show augmented proinflammatory cytokine production during acute challenges like endotoxin exposure

  • A2BAR signaling provides protection against acute ischemic and inflammatory insults

In chronic inflammatory states:

  • Prolonged ADORA2B activation may contribute to adverse tissue remodeling and fibrosis

  • The receptor stimulates production of proangiogenic and tissue-healing factors like IL-6, VEGF, and CXCL1

  • With continual exposure, these factors can promote inflammation, angiogenesis, fibrosis, and organ dysfunction

  • ADORA2B has been linked to hypertension and renal injury during experimental chronic hypertension

This dichotomy suggests a model where initial ADORA2B activation serves to limit acute inflammatory damage, but sustained signaling may promote tissue remodeling that becomes maladaptive in chronic settings. When designing experiments involving bovine ADORA2B, researchers should carefully consider the temporal context of their model system.

How can genetic knockout/mutation models enhance understanding of ADORA2B function?

Genetic knockout or mutation models have provided valuable insights into ADORA2B function. These approaches offer several methodological advantages:

  • Complete elimination of receptor function: Unlike pharmacological approaches that may have off-target effects, genetic disruption ensures complete absence of functional receptor.

  • Reporter gene integration: Knockout models can incorporate reporter genes that allow visualization of endogenous ADORA2B expression patterns. For example, A2BAR-knockout/reporter gene-knock-in mouse models have revealed receptor expression in vasculature and macrophages .

  • Phenotypic characterization across systems: Knockout models allow assessment of multi-system effects of ADORA2B deficiency, revealing:

    • Low-grade inflammation compared to matched control animals

    • Augmented proinflammatory cytokine production (e.g., TNF-α)

    • Downregulation of IκB-α and subsequent upregulation of adhesion molecules

    • Increased leukocyte adhesion to vasculature

    • Altered glucose homeostasis

    • Modified blood pressure regulation

  • Developmental vs. acquired deficiency assessment: Comparing constitutive knockouts to inducible systems or pharmacological blockade helps distinguish developmental compensation from direct receptor effects.

Recent technical advances include zinc-finger nuclease (ZFN) strategies to create ADORA2B-disrupted rat lines, such as the SS-Adora2b mutant rats with a 162-bp in-frame deletion of Adora2b that included the start codon . These models allow for more sophisticated investigation of ADORA2B in specific disease contexts like hypertension.

What are the current controversies regarding ADORA2B's role in blood pressure regulation?

Research on ADORA2B's role in blood pressure regulation has yielded apparent contradictions that require nuanced interpretation:

  • Age-dependent effects: In SS-Adora2b mutant rats, blood pressure elevated to a greater extent (~15-20 mmHg) as animals aged from 7 to 21 weeks, suggesting an anti-hypertensive role for ADORA2B in age-related hypertension .

  • Angiotensin II-dependent effects: Contrary to age-related findings, hypertension augmented by Angiotensin II infusion was attenuated in SS-Adora2b mutant rats, indicating a pro-hypertensive role in this specific context .

  • Mouse vs. rat models: In mouse studies, chronic hypertension induced by angiotensin II infusion was reduced by 50% in Adora2b−/− mice, consistent with a pro-hypertensive role .

  • Pathogenic mechanism dependence: Evidence suggests varying roles for ADORA2B signaling in regulating blood pressure, playing both anti- and pro-hypertensive roles depending on the pathogenic mechanisms involved .

These contradictions highlight the context-dependent nature of ADORA2B function and the importance of considering species differences, age, and hypertension etiology when designing and interpreting experiments.

A methodological approach to resolving these controversies would include:

  • Parallel studies in multiple species using identical interventions

  • Age-matched comparisons across different hypertension models

  • Tissue-specific conditional knockout studies to isolate vascular vs. renal effects

  • Combined pharmacological and genetic approaches to validate findings

What signaling pathways are activated downstream of ADORA2B?

ADORA2B activates several signaling pathways that mediate its diverse physiological effects:

  • cAMP/PKA pathway: The primary signaling mechanism involves stimulation of adenylate cyclase, leading to increased intracellular cAMP and protein kinase A (PKA) activation . This pathway can be measured experimentally using cAMP accumulation assays.

  • NF-κB signaling: ADORA2B influences NF-κB activity, with receptor deficiency leading to reduced levels of the NF-κB inhibitor IκB-α . This mechanism underlies the regulation of adhesion molecule expression in vascular tissues.

  • Cytokine production: ADORA2B signaling regulates the production of various cytokines, including:

    • Anti-inflammatory mediators that enhance Treg function

    • Proinflammatory cytokines like TNF-α (suppressed by ADORA2B)

    • Tissue-healing factors like IL-6, VEGF, and CXCL1

  • Glucose metabolism: ADORA2B activation influences glucose mobilization and disposal through pathways that remain to be fully characterized .

The specific signaling outcomes depend on cell type, tissue context, and disease state, which may explain the apparently contradictory roles of ADORA2B in different physiological and pathological settings.

What are established pharmacological tools for studying ADORA2B function?

Several pharmacological agents enable specific interrogation of ADORA2B function:

AgentClassificationSelectivityEC50/IC50Applications
AdenosineEndogenous agonistNon-selective adenosine receptor agonistVariableGeneral adenosine receptor activation studies
BAY 60-6583Synthetic agonistSpecific A2B receptor agonistLow μM rangeSelective ADORA2B activation; produces dose-dependent cAMP accumulation
NECASynthetic agonistNon-selective adenosine receptor agonistLow μM rangeGeneral adenosine receptor activation with higher potency than adenosine
PSB-1115AntagonistSelective A2B antagonistIC50 = 84.0 nMBlocking ADORA2B-mediated effects; competitive inhibition studies

When designing experiments with bovine ADORA2B, researchers should consider potential species differences in pharmacological response. Experimental validation of agonist and antagonist efficacy in bovine systems is recommended before conducting detailed mechanistic studies. Dose-response curves should be established for each experimental system to ensure appropriate concentration ranges .

What emerging technologies are advancing ADORA2B research?

Several cutting-edge technologies are enhancing our ability to study ADORA2B:

  • CRISPR/Cas9 gene editing: Allows for precise modification of the ADORA2B gene, enabling:

    • Introduction of specific mutations to study structure-function relationships

    • Creation of conditional knockout models for tissue-specific analysis

    • Fluorescent tagging of endogenous ADORA2B for live-cell imaging

  • Single-cell RNA sequencing: Provides insight into cell-type-specific expression patterns of ADORA2B across tissues and under different conditions, revealing heterogeneity in receptor expression and signaling responses.

  • Cryo-electron microscopy: Enables structural determination of ADORA2B in different conformational states, potentially informing structure-based drug design for selective modulators.

  • Tissue-specific receptor expression systems: The availability of expression plasmids like pCMV6-Entry with Myc-DDK-tagged ADORA2B allows for controlled expression in specific cell types .

  • Advanced animal models: Zinc-finger nuclease and other targeted gene editing approaches have created valuable new animal models, such as the SS-Adora2b mutant rat line, enabling more sophisticated in vivo studies .

These technological advances are poised to resolve current controversies and reveal new aspects of ADORA2B biology in coming years.

How might tissue-specific ADORA2B signaling inform therapeutic development?

Understanding tissue-specific ADORA2B signaling has important implications for potential therapeutic applications:

Research methodologies to advance tissue-specific understanding should include:

  • Conditional knockout studies with tissue-specific Cre-recombinase systems

  • Tissue-specific overexpression models

  • Development of tissue-targeted delivery systems for ADORA2B modulators

  • Comprehensive profiling of ADORA2B expression and signaling across tissues in health and disease states

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.