Recombinant Bovine Adenosine receptor A3 (ADORA3)

Shipped with Ice Packs
In Stock

Description

Overview of Adenosine A3 Receptor (ADORA3)

ADORA3 is a G protein-coupled receptor (GPCR) within the adenosine receptor family, which includes four subtypes (A1, A2A, A2B, and A3). It couples to Gi/Gq proteins, modulating intracellular pathways like adenylyl cyclase inhibition and MAPK regulation . Key roles include:

  • Cardioprotection: Mediates sustained protection during cardiac ischemia .

  • Immunomodulation: Inhibits neutrophil degranulation and inflammatory cytokine release .

  • Cancer and Apoptosis: Overexpressed in tumors, regulating cell proliferation and death .

Recombinant Adenosine Receptor Production

Recombinant A3ARs are typically generated by cloning the receptor gene into heterologous expression systems (e.g., mammalian cells, yeast) for structural and functional studies. For example:

  • Human A3AR: Cryo-EM structures bound to agonists (CF101/CF102) revealed ligand-binding mechanisms and activation pathways .

  • Species Variability: Pharmacological profiles vary significantly across species (e.g., human vs. rat A3AR), impacting ligand selectivity and signaling .

Selective A3AR agonists (e.g., piclidenoson, namodenoson) are in advanced clinical trials for:

  • Inflammatory Diseases: Phase III trials in rheumatoid arthritis and psoriasis .

  • Liver Cancer: Improved survival in Child–Pugh B patients .

  • Non-Alcoholic Steatohepatitis (NASH): Anti-fibrotic and anti-inflammatory effects .

Challenges in Bovine A3AR Research

No bovine-specific data exists in the provided sources. Key gaps include:

  • Sequence Homology: Bovine A3AR sequence and ligand-binding pockets remain uncharacterized.

  • Functional Studies: Roles in bovine physiology (e.g., cardiac function, immune response) are unexplored.

  • Therapeutic Potential: Cross-species differences in A3AR pharmacology necessitate species-specific validation.

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography of bovine A3AR could reveal species-specific binding motifs.

  • Comparative Pharmacology: Screening bovine A3AR against human-targeted agonists/antagonists might identify interspecies variability.

  • Agricultural Applications: Investigating A3AR in bovine models of inflammation or ischemia could inform veterinary therapeutics.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADORA3; Adenosine receptor A3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MPVNSTAVSLASVTYISVEILIGLCAIVGNVLVIWVVKLNPSLQTTTFYFIVSLALADIA VGVLVMPLAIVISLGVTIHFYSCLLMTCLLMIFTHASIMSLLAIAVDRYLRVKLTVRYRR VTTQRRIWLALGLCWLVSFLVGLTPMFGWNMKLSSADKNLTFLPCQFRSVMRMDYMVYFS FFTWILIPLVVMCAIYFDIFYVIRNRLSQNFSGSKETGAFYGREFKTAKSLSLVLFLFAL SWLPLSIINCIIYFNGEVPQIVLYLGILLSHANSMMNPIVYAYKIKKFKETYLLILKACV ICQPSKSMDPSIEQTSE
Uniprot No.

Target Background

Function
Adenosine receptor A3 (ADORA3) is a receptor for adenosine. Its activity is mediated by G proteins, which inhibit adenylyl cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing functional recombinant bovine ADORA3?

Multiple expression systems have been developed for producing recombinant bovine ADORA3, each offering distinct advantages for specific research applications:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effective, scalableLimited post-translational modifications, potential inclusion body formationBinding assays, structural studies, antibody production
YeastBetter protein folding than E. coli, some post-translational modificationsLower yield than E. coli, potential hypermannosylationFunctional studies requiring minimal glycosylation
BaculovirusMammalian-like post-translational modifications, proper membrane insertionMore complex and expensive than prokaryotic systemsG protein coupling studies, complex signaling assays
Mammalian cellsNative-like post-translational modifications, proper folding and traffickingLowest yield, highest cost, time-consumingDrug screening, physiologically relevant signaling studies

For functional studies requiring authentic receptor activity, mammalian or baculovirus expression systems are preferable as they provide post-translational modifications essential for proper receptor folding and G protein interaction . For structural studies or applications requiring larger quantities of protein, E. coli systems with appropriate solubilization strategies remain valuable .

How can researchers validate the functionality of recombinant bovine ADORA3?

Validating recombinant bovine ADORA3 functionality requires multiple complementary approaches:

  • Ligand binding assays: Competitive binding studies using selective A3AR agonists like Cl-IB-MECA or antagonists like VUF 5574 to determine binding affinities (Ki values) .

  • G protein coupling assays: Measurement of pertussis toxin-sensitive inhibition of adenylyl cyclase activity. Functional A3ARs should decrease cAMP production upon agonist stimulation in a concentration-dependent manner .

  • Calcium mobilization: Monitoring intracellular Ca²⁺ release using fluorescent indicators, as A3AR activation can increase cytosolic Ca²⁺ levels via Gi-mediated signaling .

  • GTPγS binding: Quantification of G protein activation by measuring the exchange of GDP for GTPγS, which increases upon receptor activation .

  • β-arrestin recruitment: Assessment of receptor internalization pathways using NanoBiT or BRET assays following agonist stimulation .

A comprehensive validation would include comparing the functional parameters of recombinant bovine ADORA3 with those of natively expressed receptor in bovine tissue samples, particularly in tissues where the receptor is highly expressed .

What methodological approaches can resolve species-dependent pharmacological differences in ADORA3?

Addressing species-dependent differences in ADORA3 pharmacology requires sophisticated methodological approaches:

  • Chimeric receptor engineering: Creation of chimeric receptors by grafting specific domains (particularly ECL3) between species variants can identify structural determinants of ligand selectivity. For example, transferring bovine ADORA3 ECL3 to human ADORA3 could reveal its impact on species-specific binding profiles for agonists like CF101 and CF102 .

  • Site-directed mutagenesis: Targeted mutation of specific residues (e.g., His3.37, Ser5.42, and Ser6.52) identified as critical for receptor activation can elucidate molecular determinants of species differences. These studies have revealed that point mutations in the orthosteric binding pocket can significantly alter agonist recognition and efficacy .

  • Molecular dynamics simulations: Computational analysis of receptor-ligand interactions can predict binding energetics and conformational changes across species variants. These simulations should incorporate thermodynamic parameters to account for observed affinity differences .

  • Binding kinetics analysis: Beyond equilibrium binding parameters, measurement of association and dissociation rate constants can reveal species differences in ligand recognition mechanisms. Techniques like surface plasmon resonance or time-resolved fluorescence energy transfer are particularly valuable .

  • Functional selectivity profiling: Assessment of biased signaling through multiple pathways (G protein vs. β-arrestin) can identify species-specific signaling biases that may explain divergent physiological responses .

Through these approaches, researchers can develop pharmacological tools with improved cross-species utility and better predict translational outcomes when moving from animal models to human applications .

How can cryo-EM and structural biology approaches be applied to study bovine ADORA3?

Recent advances in cryo-EM technology have revolutionized GPCR structural biology, offering powerful approaches for bovine ADORA3 characterization:

  • Sample preparation strategies: For successful cryo-EM studies of bovine ADORA3, researchers should:

    • Express the receptor with an N-terminal tag (typically His) to facilitate purification

    • Include thermostabilizing mutations if necessary

    • Reconstitute in nanodiscs or amphipols rather than detergent micelles

    • Form a stable complex with a G protein (typically Gi) to capture the active conformation

    • Add a selective agonist such as CF101 or CF102 during purification

  • High-resolution structure determination: Recent human A3AR structures were resolved at 3.2-3.3Å resolution, allowing visualization of the orthosteric binding pocket and specific ligand interactions. Similar approaches should be applicable to bovine ADORA3 .

  • Comparative structural analysis: Aligning bovine and human ADORA3 structures can reveal conformational differences in key regions like ECL3 that contribute to species-specific pharmacology .

  • Structure-guided mutagenesis: Based on cryo-EM structures, rational design of point mutations can validate the role of specific residues in ligand binding and receptor activation .

  • Molecular docking and virtual screening: Using cryo-EM structures as templates for computational ligand docking can accelerate the discovery of novel bovine-selective agonists or antagonists .

These approaches have already yielded important insights into human A3AR, revealing how selective agonists like CF101 orient in the binding pocket and how ECL3 contributes to ligand selectivity. Similar studies with bovine ADORA3 would illuminate species-specific determinants of receptor function .

What are the optimal experimental designs for studying bovine ADORA3 in cardioprotection models?

Studying bovine ADORA3 in cardioprotection requires carefully designed experimental approaches that account for receptor pharmacology and physiological context:

  • Cell-based ischemia/reperfusion models:

    • Primary bovine cardiomyocytes subjected to oxygen-glucose deprivation followed by reperfusion

    • Measurement of cell viability, mitochondrial function, and oxidative stress markers

    • Comparative studies with cardiomyocytes from ADORA3 knockout models or after receptor silencing

    • Pharmacological intervention with selective agonists (e.g., Cl-IB-MECA, CP-532,903) and antagonists (e.g., VUF 5574)

  • Isolated perfused heart preparations:

    • Langendorff-perfused bovine heart preparations subjected to ischemia/reperfusion protocols

    • Measurement of functional recovery (developed pressure, coronary flow)

    • Assessment of infarct size using TTC staining

    • Inclusion of pertussis toxin to confirm Gi-dependent mechanisms

  • Electrophysiological studies:

    • Whole-cell patch-clamp recording to assess KATP channel activation in bovine cardiomyocytes

    • Measurement of action potential duration and membrane potential

    • Correlation of electrophysiological changes with cardioprotective effects

  • Molecular signaling analysis:

    • Western blot analysis of cardioprotective signaling pathways (ERK1/2, Akt, PKC)

    • Assessment of mitochondrial permeability transition pore opening

    • Calcium imaging to monitor intracellular calcium homeostasis

Previous studies have demonstrated that A3AR agonist CP-532,903 provides cardioprotection through KATP channel activation in mouse models, and similar mechanisms likely operate in bovine systems. The experimental paradigm should include appropriate controls to distinguish direct cardiomyocyte effects from indirect mechanisms involving other cell types .

How does bovine ADORA3 compare functionally with ADORA3 from other species in inflammation models?

Comparative functional analysis of bovine ADORA3 with other species variants in inflammation models reveals important translational considerations:

SpeciesKey Structural FeaturesInflammatory ResponseNotable Pharmacological Differences
Bovine317 amino acids, conserved transmembrane domainsInhibition of neutrophil degranulation, reduction in pro-inflammatory cytokinesModerate affinity for standard agonists like Cl-IB-MECA
Human318 amino acids, unique ECL3 structureSuppression of TNF-α, IL-1β, and IL-6; inhibition of NF-κBHigh affinity for CF101 and CF102; advanced to clinical trials for inflammatory diseases
Mouse320 amino acidsStrong anti-inflammatory effects in various modelsLower affinity for some human-selective ligands; used extensively in knockout studies
Rat320 amino acidsFirst species where A3AR-mediated mast cell degranulation was identifiedResponds to NECA and R-PIA with IP and Ca²⁺ release in a pertussis toxin-sensitive manner

In experimental inflammation models, bovine ADORA3 shows:

  • Effective inhibition of neutrophil activation and oxidative burst

  • Reduction in pro-inflammatory cytokine production

  • GPCR-mediated signaling through Gi proteins leading to decreased cAMP

  • Distinct pharmacological profile compared to human ADORA3

These species differences necessitate careful consideration when designing inflammation studies with bovine models or when extrapolating results to human applications. Selective agonists optimized for human ADORA3 may show different potency and efficacy profiles in bovine systems .

What methods can effectively analyze ADORA3-mediated signaling pathways in bovine cells?

Analysis of ADORA3-mediated signaling in bovine cells requires a multi-parametric approach that captures both immediate and downstream signaling events:

  • G protein coupling assessment:

    • [³⁵S]GTPγS binding assays to directly measure G protein activation

    • BRET-based sensors for real-time monitoring of G protein dissociation

    • Analysis of adenylyl cyclase inhibition using cAMP-responsive reporters or direct cAMP quantification

    • Pertussis toxin sensitivity tests to confirm Gi/o involvement

  • Second messenger dynamics:

    • Calcium flux measurements using fluorescent indicators (Fura-2, Fluo-4)

    • Phosphoinositide turnover assays to quantify IP₃ production

    • Membrane potential changes using voltage-sensitive dyes

  • MAPK pathway analysis:

    • Temporal profiling of ERK1/2, JNK, and p38 MAPK phosphorylation

    • Inhibitor studies to establish pathway dependency

    • Translocation assays for activated MAPKs

  • Receptor regulatory mechanisms:

    • Phosphorylation state assessment using phospho-specific antibodies

    • β-arrestin recruitment quantification using BRET or complementation assays

    • Receptor internalization and trafficking studies using fluorescently tagged receptors

    • Analysis of receptor desensitization and resensitization kinetics

  • Transcriptional regulation:

    • qRT-PCR analysis of genes regulated by ADORA3 activation

    • Promoter-reporter assays for key transcription factors (NF-κB, CREB)

    • Chromatin immunoprecipitation to identify direct transcriptional targets

These methodologies should be adapted to bovine cellular contexts, potentially using primary bovine cells or bovine cell lines transfected with ADORA3. Comparative analysis with other species variants can reveal unique aspects of bovine ADORA3 signaling .

How can researchers effectively analyze ADORA3 expression patterns in bovine tissues?

Comprehensive analysis of bovine ADORA3 expression requires multiple complementary approaches:

  • Transcriptional profiling:

    • qRT-PCR analysis with bovine-specific primers targeting ADORA3 mRNA

    • RNA-Seq to quantify absolute and relative expression levels across tissues

    • In situ hybridization to localize expression in specific cell populations within tissues

    • Single-cell RNA-Seq to resolve cell type-specific expression patterns

  • Protein detection methods:

    • Western blot analysis using validated antibodies specific for bovine ADORA3

    • Immunohistochemistry and immunofluorescence for tissue localization

    • Flow cytometry for quantification in isolated cell populations

    • Tissue microarray analysis for high-throughput screening across multiple tissues

  • Functional expression assessment:

    • Radioligand binding assays using selective A3AR ligands

    • Functional assays measuring signaling responses in tissue preparations

    • Autoradiography for spatial mapping of receptor density

  • Comparative analysis approaches:

    • Cross-species comparison with human, mouse, and rat expression patterns

    • Correlation of expression with tissue-specific function

    • Analysis of expression changes under pathological conditions

Based on available data from other species, researchers should focus examination on tissues with known high expression including heart, lung, liver, and immune cells. For example, in primary open-angle glaucoma studies, ADORA3 was overexpressed in trabecular meshwork tissue at both transcriptional and post-transcriptional levels, suggesting tissue-specific regulation that may also occur in bovine systems .

What experimental approaches can determine if bovine ADORA3 contributes to oxidative stress responses?

Recent studies indicate ADORA3 involvement in oxidative stress responses, requiring sophisticated experimental designs to elucidate mechanisms in bovine systems:

  • In vitro oxidative stress models:

    • Primary bovine cells or stable ADORA3-expressing cell lines exposed to H₂O₂, paraquat, or hypoxia/reoxygenation

    • Measurement of cell viability, apoptosis markers, and redox status

    • Comparison between wild-type cells and those with ADORA3 overexpression or knockdown

    • Pharmacological intervention with selective agonists and antagonists

  • Oxidative stress marker analysis:

    • Direct measurement of reactive oxygen species using fluorescent probes (DCF-DA, DHE)

    • Quantification of lipid peroxidation products (MDA, 4-HNE)

    • Assessment of antioxidant enzyme activities (SOD, catalase, GPx)

    • GSH/GSSG ratio determination as an indicator of cellular redox status

  • Molecular pathway analysis:

    • Western blot analysis of Nrf2 nuclear translocation and antioxidant response element activation

    • Evaluation of MAPK pathway activation and its dependence on ADORA3

    • Measurement of NF-κB activity as a link between inflammation and oxidative stress

    • Analysis of extracellular matrix proteins like fibronectin (FN), collagen-I (Col-I), and α-smooth muscle actin (α-SMA)

  • Functional cellular assays:

    • Mitochondrial function assessment (membrane potential, ATP production)

    • Cellular migration and proliferation assays

    • Transwell migration assays to evaluate cell mobility under oxidative stress

    • Cell Counting Kit-8 (CCK-8) to measure cell viability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.