Recombinant Bovine ADP-ribosylation factor-like protein 6-interacting protein 6 (ARL6IP6)

Shipped with Ice Packs
In Stock

Description

Introduction

ADP-ribosylation factor-like protein 6-interacting protein 6 (ARL6IP6) is a protein associated with the ARF-like GTPase family . Research indicates that ARL6IP6 interacts with other proteins and may play a role in tumor development and immune responses .

Basic Information

ARL6IP6, also known as ARF like GTPase 6 interacting protein 6, is encoded by the ARL6IP6 gene . The human ARL6IP6 gene, with Gene ID: 151188, was last updated on February 9, 2025 . It is predicted to be located in the nuclear inner membrane .

Expression Analysis

ARL6IP6 expression has been analyzed in various tissues and tumors . Studies using the GEPIA database show that ARL-6 mRNA expression is significantly upregulated in hepatocellular carcinoma (HCC) tissues compared to normal tissues . Immunohistochemistry also confirms higher ARL-6 protein expression in HCC tissues versus para-carcinoma tissues .

3.1. Expression and Clinical Features

ARL-6 expression varies significantly across different liver hepatocellular carcinoma (LIHC) characteristics, including sample type, histological subtype, TP53 mutation status, nodal metastatic status, and cancer stage .

Experimental Methods

Several methods are used to study ARL6IP6, including:

  • Cell Counting Kit 8 (CCK8): Used in cell proliferation assays .

  • Flow Cytometry: Used to analyze cell populations .

  • Transwell Invasion Assay: Used to assess cell invasion capabilities .

  • GEPIA Data Analysis: Utilizes data from The Cancer Genome Atlas (TCGA) and the Genotype-Tissue Expression (GTEx) projects to analyze survival outcomes in HCC patients .

  • UALCAN Data Analysis: Compiles data from TCGA and the MET500 sequencing project to determine ARL-6 expression in normal and cancerous tissues .

  • TIMER Database Analysis: Investigates cellular immune infiltrations and clinical medical risks, focusing on ARL-6 expression in advanced liver cancer and immune cell infiltrations .

  • TCGA Database Analysis: Accesses RNA-sequencing expression profiles and clinical data for HCC .

  • GeneMANIA: An online tool that explores protein and genetic interactions, domain protein similarities, co-expression, co-localization, and functional associations within the context of target genes .

ARL6 Gene Infiltration by Immune Cells in HCC Cases

The TIMER database was used to investigate the correlation between immune cell infiltration and variations in ARL6 gene expression . A significant association was found among ARL6 expression and the infiltration of dendritic cells, neutrophils, macrophages, CD4+ T cells, CD8+ T cells, and B cells .

Prognostic Value

Increased ARL-6 expression is associated with worse survival in LIHC . High levels of ARL-6 transcription are significantly correlated with decreased DFS in patients with HCC .

Table: ARL-6 Expression in Carcinoma and Para-Carcinoma Tissues

IndexCarcinoma tissues (N=26)Paired para-carcinoma tissues (N=26)tP value
Mean Density (Mean±SD)0.26±0.050.21±0.036.366<0.0001
H-Score (Mean±SD)159.86±27.99131.36±21.774.759<0.0001
IRS (Mean±SD)6.46±1.984.92±1.723.953<0.001

Functional Enrichment Evaluation

Using GeneMINIA, an interconnected matrix of ARL-6 and functionally associated genes was constructed to investigate the underlying mechanistic controls of ARL-6 members in HCC . The analysis revealed 20 genes, such as ARL6IP6, ATL2, ARL6IP1, ARL6IP4, BBIP1, ARL6IP5, UNC50, CEP19, KIAA0895, ATXN10, IQCB1, CADPS2, PLEKHA3 .

Therapeutic Implications

ARL-6 is a potential target for new therapies for HCC, addressing the need for more effective treatment options .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ARL6IP6; ADP-ribosylation factor-like protein 6-interacting protein 6; ARL-6-interacting protein 6; Aip-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MSFVESGRRSAPLRRRPGTPVPFARPAYSVFSQGDSWGEGEVEEEEGCDQVARDLRAEFS AGSSSKLRKDPVLQPDGDGSPVLPDKRNGIFSADAGGKALARRWPVQVLSILCSLLFAIL LACLLAITYLIVKELHAENLKNEDDVNTGLLGFWSLLIISLTAGFSCCSFSWTVTYFDSF EPGMFPPTPLSPARFKKMTGHSFHMGYSMAILNGIVAALTVAWCLM
Uniprot No.

Target Background

Database Links

KEGG: bta:507137

UniGene: Bt.36166

Protein Families
ARL6IP6 family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein.

Q&A

What is ARL6IP6 and what cellular functions has it been associated with?

ARL6IP6 (ADP-ribosylation factor-like GTPase 6 interacting protein 6) is an uncharacterized membrane protein that has been shown to localize to the inner nuclear membrane . It belongs to the ARL6IP6 family and is a multi-pass membrane protein consisting of 226 amino acids in mice .

Recent research has implicated ARL6IP6 in:

  • Viral replication processes, particularly in Human Cytomegalovirus (HCMV) infection cycles

  • Membrane protein trafficking pathways

  • ER-associated structures formation during infection

  • Potential role in neurodegenerative processes, as evidenced by its downregulation in neuronopathic mucopolysaccharidoses (MPS)

The protein appears to play important roles in post-viral DNA replication processes rather than directly affecting viral genome replication, suggesting involvement in viral assembly or maturation .

How is the ARL6IP6 gene structured and organized?

In humans, the ARL6IP6 gene:

  • Spans from position 152,717,893 to 152,761,253 on the plus strand

  • Contains 43,361 bases and 11 exons

  • Is located on the long arm of chromosome 2, at position 2q23.3

  • Has three upstream genes (PRPF40A, FMNL2, and STAM2) and three downstream genes (GALNT13, KCNJ3, NR4A2) that define the genomic region

ARL6IP6 is also known by several alternative names including:

  • AIP-6 (ARL-6-interacting protein 6)

  • PFAAP1 (Phosphonoformate immuno-associated protein 1)

  • AIP6

What detection methods are available for studying ARL6IP6 expression?

Several methods have been validated for detecting and analyzing ARL6IP6:

Protein Detection:

  • Western Blot (recommended antibody dilution: 0.4 μg/ml)

  • Immunohistochemistry (recommended dilution range: 1:10-1:500)

  • Immunocytochemistry/Immunofluorescence (recommended concentration: 1-4 μg/ml)

  • Immunohistochemistry-Paraffin (recommended dilution range: 1:200-1:500)

Gene Expression Analysis:

  • RT-qPCR using primers targeting ARL6IP6 exons

  • RNA-sequencing with appropriate normalization for low-abundance transcripts

Subcellular Localization:

  • Fluorescence microscopy using tagged versions of ARL6IP6 (e.g., strep-tagged ARL6IP6)

  • Co-localization studies with markers such as calnexin (for ER structures)

When designing experiments, consider that ARL6IP6 may be expressed at relatively low levels in some tissues, requiring sensitive detection methods.

How does ARL6IP6 affect viral replication cycles, particularly in HCMV infection?

ARL6IP6 has been identified as a strong dependency factor in HCMV infection through CRISPR-based screens (fitness factor = 0.31) . Experimental evidence shows:

  • CRISPR knockout of ARL6IP6 severely reduces HCMV propagation

  • This reduction is not mediated through inhibition of viral DNA replication, suggesting involvement in post-replication processes

  • During HCMV infection, ARL6IP6 undergoes dramatic relocalization from the inner nuclear membrane to cytoplasmic structures that partially engulf the viral assembly compartment

  • These ARL6IP6-containing structures are reminiscent of ER-derived structures that form late in infection

  • ARL6IP6 co-localizes with calnexin, an ER marker, in these infection-induced structures

The abundance profiles of sgRNAs targeting ARL6IP6 in VECOS (Virally Encoded CRISPR/Cas Orthogonal Screens) showed minimal changes in infected cells but significant reduction in infectious progeny, confirming that ARL6IP6 depletion primarily affects post-viral DNA replication processes .

Methodologically, researchers investigating ARL6IP6's role in viral infection should:

  • Design time-course experiments to capture dynamic relocalization

  • Integrate multiple imaging techniques with viral titer measurements

  • Consider complementation assays with mutant ARL6IP6 variants to identify functional domains

What are the recommended approaches for creating ARL6IP6 knockout models?

Based on the search results, several approaches for ARL6IP6 knockout have been validated:

CRISPR/Cas9-based Knockout:

  • Well-designed guide RNAs targeting ARL6IP6 have been developed by the Feng Zhang laboratory at the Broad Institute

  • When ordering gRNA clones, researchers should select vectors that include appropriate selection markers

  • It is recommended to order at least two gRNA constructs per target gene to increase success rates

  • Researchers should verify gRNA sequences against their specific target gene sequence before ordering, especially when targeting specific splice variants or exons

siRNA-based Knockdown:

  • Commercial siRNAs targeting ARL6IP6 are available (e.g., sc-141247 from Santa Cruz Biotechnology)

  • Typical siRNA products contain 3.3 nmol of lyophilized siRNA, sufficient for multiple transfections

Experimental Design Considerations:

  • Include appropriate controls to verify knockout efficiency (e.g., Western blot, RT-qPCR)

  • For viral infection studies, monitor both intracellular viral components and infectious progeny separately

  • Be aware that complete knockout may have different effects than partial knockdown

  • Consider inducible systems for studying dynamic processes

A common experimental validation approach is to confirm reduced ARL6IP6 expression and then measure the phenotypic effects, such as viral titers in infection studies .

How does ARL6IP6 subcellular localization change during cellular stress or infection?

ARL6IP6 exhibits remarkable dynamic localization during cellular stress conditions, particularly during viral infection:

In Uninfected Cells:

  • ARL6IP6 primarily localizes to the inner nuclear membrane

  • It maintains a relatively stable distribution pattern under normal cellular conditions

During HCMV Infection:

  • Late in infection, ARL6IP6 dramatically relocalizes to cytoplasmic structures

  • These structures partially engulf the viral assembly compartment

  • The relocalized ARL6IP6 co-localizes with calnexin, an ER marker protein

  • This suggests ARL6IP6 becomes incorporated into ER-derived structures that form during infection

To study these dynamic changes, researchers have successfully used:

  • Fluorescence microscopy with tagged versions of ARL6IP6 (e.g., strep-tagged)

  • Co-immunostaining with markers for cellular compartments

  • Time-course experiments to capture the progression of relocalization

This relocalization pattern suggests ARL6IP6 may play important roles in membrane reorganization during stress conditions or infection processes. Understanding these dynamics could provide insights into cellular adaptation mechanisms and potential therapeutic targets.

What methodological approaches are recommended for studying ARL6IP6 protein-protein interactions?

To effectively investigate ARL6IP6 protein-protein interactions, researchers can employ several complementary approaches:

Affinity Purification-Mass Spectrometry (AP-MS):

  • Express tagged versions of ARL6IP6 (e.g., Strep-tagged as described in result )

  • Perform pull-down experiments under various conditions (normal, stress, infection)

  • Analyze interacting partners by mass spectrometry

  • Validate key interactions through reciprocal pull-downs

Proximity Labeling Approaches:

  • BioID or TurboID fusion proteins can identify proximal proteins in living cells

  • Particularly valuable for membrane proteins like ARL6IP6

  • Can capture transient interactions that might be lost in traditional co-IP approaches

Network Analysis:

  • Use tools like GeneMINIA to construct interaction networks

  • Results from one study identified 20 genes functionally associated with ARL6 (although this refers to ARL6 rather than ARL6IP6), including ARL6IP6, ATL2, ARL6IP1, ARL6IP4, BBIP1, ARL6IP5, and others

Co-localization Studies:

  • Fluorescence microscopy with differentially labeled proteins

  • Particularly important during dynamic processes like viral infection

  • Can provide spatial and temporal context to interactions

When designing these experiments, researchers should be aware of potential artifacts from overexpression systems and consider the membrane-bound nature of ARL6IP6 when optimizing lysis and purification conditions.

How can researchers address data quality issues and batch effects in ARL6IP6 expression analysis?

When analyzing ARL6IP6 expression data, particularly across multiple samples or datasets, several methodological considerations are essential:

Handling Outliers:

  • Approach outliers cautiously rather than hastily removing them

  • Understand whether outliers represent natural variation or technical errors

  • Document clear criteria for any outlier exclusion in research reports

Batch Effect Correction:

  • Account for batch effects when integrating data from different sources

  • Use appropriate statistical methods for batch correction (e.g., ComBat, RUVSeq)

  • Include batch information in experimental design to allow for proper modeling

Gene Name Standardization:

  • Be aware of potential gene name conversion issues in software like Excel

  • Microsoft has released updates allowing users to disable automatic data conversion

  • Ensure consistent genome versions when comparing ARL6IP6 expression across datasets

Comprehensive Data Documentation:

  • Document all experimental conditions and potential confounding factors

  • Particularly important for patient-derived samples or experiments conducted at different times

  • Include information about sample processing methods that might affect expression measurements

For ARL6IP6 specifically, researchers should:

  • Consider its relatively low expression levels in some tissues when designing experiments

  • Be aware of potential splice variants that might be differentially detected

  • Validate expression changes using multiple methodologies

  • Account for dynamic subcellular relocalization that might affect protein quantification

What is known about ARL6IP6's potential role in neurodegenerative disorders?

Recent research has implicated ARL6IP6 in neurodegenerative processes:

  • ARL6IP6 was identified as a down-regulated gene in neuronopathic mucopolysaccharidoses (MPS) types, along with other genes like ABHD5, PDE4DIP, YIPF5, and CLDN11

  • These gene expression changes were observed in fibroblasts from patients with neuronopathic forms of MPS (severe forms of MPS I and II, all MPS III and MPS VII)

  • The altered expression profile was not present in non-neuronopathic MPS types (mild forms of MPS I and II, all MPS IV, MPS VI, and MPS IX)

This differential expression pattern suggests ARL6IP6 might be involved in:

  • Cellular processes affected in neurodegenerative conditions

  • Potential adaptation or compensatory mechanisms in response to lysosomal dysfunction

  • Pathways related to central nervous system maintenance

Researchers investigating ARL6IP6 in neurodegenerative contexts should consider:

  • Comparing expression levels across different neurological conditions

  • Examining specific cell types where ARL6IP6 changes might be most pronounced

  • Investigating the consequences of experimentally manipulating ARL6IP6 levels in neuronal models

  • Exploring the relationship between ARL6IP6 and other genes known to be dysregulated in neurodegenerative conditions

How is ARL6IP6 expression altered in cancer, and what are the implications?

Studies examining ARL6IP6 in cancer contexts have revealed several important findings:

While direct information about ARL6IP6 in cancer is limited in the provided search results, related research on ARL-6 shows:

Methodological approaches for investigating ARL6IP6 in cancer research include:

  • Comprehensive database analysis using platforms like TCGA, UALCAN, and TIMER

  • Immunohistochemical staining of tissue sections with appropriate ARL6IP6 antibodies

  • Expression correlation analyses with immune cell markers

  • Survival analyses using Kaplan-Meier curves and Cox proportional hazards models

What expression systems are optimal for producing recombinant bovine ARL6IP6?

Based on available information about ARL6IP6 protein production:

Cell-Free Protein Synthesis (CFPS):

  • ALiCE® (Almost Living Cell-Free Expression System), based on Nicotiana tabacum c.v. lysate, has been successfully used for ARL6IP6 production

  • This system contains protein expression machinery needed for difficult-to-express proteins, including those requiring post-translational modifications

  • During lysate production, cell walls and unnecessary cellular components are removed, leaving only the protein production machinery and mitochondria

Mammalian Expression Systems:

  • HEK-293 cells have been used for recombinant ARL6IP6 production

  • These systems may be particularly suitable for studying properly folded and post-translationally modified ARL6IP6

Purification Approaches:

  • Strep-Tag labeling has been successfully implemented for ARL6IP6 purification

  • Purification should achieve >70-80% purity as determined by SDS-PAGE, Western Blot, and analytical SEC (HPLC)

When designing recombinant bovine ARL6IP6 expression, researchers should consider:

  • The multi-pass membrane nature of ARL6IP6, which may complicate expression and purification

  • Potential species-specific differences in post-translational modifications

  • The need for proper folding of transmembrane domains

  • Appropriate detergents for solubilization while maintaining protein structure and function

What quality control measures are essential for recombinant ARL6IP6 characterization?

Ensuring the quality of recombinant ARL6IP6 requires comprehensive characterization:

Purity Assessment:

  • SDS-PAGE for basic purity evaluation

  • Western blotting with specific anti-ARL6IP6 antibodies

  • Analytical size exclusion chromatography (SEC-HPLC)

Functional Validation:

  • ELISA-based binding assays

  • Structure-function analyses

  • Application-specific activity tests

Identity Confirmation:

  • Mass spectrometry to confirm protein sequence

  • Peptide mapping

  • N-terminal sequencing

Stability Analysis:

  • Thermal stability assessments

  • Freeze-thaw stability testing

  • Long-term storage condition optimization

From the search results, we know that recombinant mouse ARL6IP6 (AA 1-226) with Strep-Tag has been successfully produced with >70-80% purity , suggesting similar approaches could be applied to bovine ARL6IP6.

For bovine-specific applications, researchers should additionally consider:

  • Species-specific antibody validation

  • Comparison with native bovine ARL6IP6 (if available)

  • Cross-species functional comparisons to assess conservation of activity

How should researchers interpret contradictory findings about ARL6IP6 function across different experimental systems?

When faced with contradictory findings about ARL6IP6 function, researchers should consider several methodological approaches:

Systematic Model Comparison:

  • Document differences in experimental systems (cell types, species, environmental conditions)

  • Consider developmental stage and tissue-specific factors that might influence ARL6IP6 function

  • Analyze protein expression levels across systems, as overexpression may cause artifactual results

Context-Dependent Functions:

  • Investigate whether ARL6IP6 has distinct functions in different cellular contexts

  • For example, ARL6IP6's role in HCMV infection (post-viral DNA replication processes) may differ from its potential roles in neurodegenerative disorders

  • Consider interaction partners that may be differentially expressed across systems

Technical Considerations:

  • Evaluate differences in knockout/knockdown efficiency

  • Compare acute versus chronic depletion approaches

  • Assess antibody specificity across different applications

Integrated Analysis Framework:

  • Generate clear hypotheses about context-dependent functions

  • Design experiments with appropriate controls that directly address contradictions

  • Use multiple methodologies to validate key findings

  • Consider compensatory mechanisms that might mask phenotypes in some systems

The finding that NAA30 depletion had opposing effects between viral DNA replication and infectious progeny production provides a relevant example of how proteins can have pleiotropic effects that manifest differently depending on the specific readout being measured.

What bioinformatic approaches are most effective for analyzing ARL6IP6 in single-cell datasets?

When analyzing ARL6IP6 expression and function in single-cell datasets, several specialized approaches should be considered:

Handling Data Sparsity:

  • Single-cell RNA sequencing data often suffers from sparsity due to dropout events

  • Implement appropriate normalization methods designed for sparse data

  • Consider imputation approaches, but be cautious about introducing artifacts

Uncertainty Quantification:

  • Accurately quantify uncertainties arising from experimental errors and biases

  • Prevent uncertainties from propagating to downstream analyses

  • Translate uncertainties into statistical confidence measures

Batch Effect Management:

  • Single-cell data is particularly susceptible to batch effects

  • Use spike-in RNA of known content and concentration as negative controls

  • Apply batch correction methods specifically designed for single-cell data

Cell Type-Specific Analysis:

  • Examine ARL6IP6 expression patterns across different cell populations

  • Investigate potential co-expression patterns with known cell-type markers

  • Consider trajectory analyses to identify dynamic changes in ARL6IP6 expression during cellular processes

Validation Approaches:

  • Use multiple single-cell technologies to validate findings

  • Confirm key results with orthogonal methods (e.g., smFISH, immunofluorescence)

  • Benchmark analysis tools systematically using appropriate metrics

For ARL6IP6 specifically, researchers should be aware that its expression may be heterogeneous across cell populations, and its membrane-bound nature might affect RNA capture efficiency in some single-cell protocols.

What are the most promising unexplored research areas related to ARL6IP6?

Based on current knowledge gaps identified in the search results, several promising research directions emerge:

Structural Biology:

  • Determine the three-dimensional structure of ARL6IP6

  • Identify functional domains and their specific roles

  • Characterize membrane topology and potential conformational changes

Regulatory Mechanisms:

  • Investigate transcriptional and post-transcriptional regulation of ARL6IP6

  • Identify signaling pathways that modulate ARL6IP6 localization and function

  • Explore potential post-translational modifications

Evolutionary Biology:

  • Conduct comprehensive comparative analyses across species

  • Identify conserved functional elements versus species-specific adaptations

  • Explore the evolution of ARL6IP6 in relation to other ARL family proteins

Disease Associations:

  • Expand studies of ARL6IP6 in neurodegenerative disorders beyond MPS

  • Further investigate connections to cancer progression and immune cell infiltration

  • Explore potential roles in other membrane-related pathologies

Therapeutic Applications:

  • Evaluate ARL6IP6 as a potential therapeutic target in viral infections

  • Assess its utility as a biomarker for disease progression or treatment response

  • Develop tools to modulate ARL6IP6 function in disease contexts

The significant relocalization of ARL6IP6 during HCMV infection and its differential expression in neurodegenerative conditions suggest it may play crucial roles in cellular adaptation to stress, representing a particularly promising avenue for future research.

What interdisciplinary approaches might yield new insights into ARL6IP6 biology?

Advancing ARL6IP6 research will benefit from integrating multiple disciplines:

Systems Biology and Network Analysis:

  • Map comprehensive interaction networks around ARL6IP6

  • Identify hub proteins and key regulatory nodes

  • Model dynamic changes in these networks during cellular processes

  • The identified 20 genes functionally associated with ARL-6, including various ARL6IP family members , provide a starting point for such analyses

Advanced Imaging Technologies:

  • Apply super-resolution microscopy to precisely track ARL6IP6 localization

  • Use live-cell imaging to observe dynamic relocalization events

  • Implement correlative light and electron microscopy to connect molecular-scale events with ultrastructural changes

Computational Biology:

  • Develop machine learning approaches to predict ARL6IP6 functions from sequence data

  • Create models of membrane protein dynamics

  • Simulate the effects of ARL6IP6 perturbation on cellular processes

Translational Research:

  • Connect basic ARL6IP6 biology to clinically relevant outcomes

  • Develop biomarkers based on ARL6IP6 expression or localization patterns

  • Explore therapeutic strategies targeting ARL6IP6 or its interaction partners

Multi-Omics Integration:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Account for differences in naming conventions and data structures when integrating datasets

  • Harmonize data to avoid compatibility issues and biased results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.