Recombinant Bovine ADP/ATP translocase 2 (SLC25A5)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of ADP/ATP Translocase 2

ADP/ATP translocase 2, also known as SLC25A5, belongs to the mitochondrial carrier subfamily of solute carrier protein genes. This protein functions primarily as an antiporter that catalyzes the exchange of mitochondrial ATP with cytosolic ADP across the inner mitochondrial membrane . The protein is referred to by several synonyms in scientific literature, including adenine nucleotide translocator 2 (ANT2), ADP/ATP carrier protein 2, and solute carrier family 25 member 5 .

The main function of SLC25A5 is to catalyze the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane, which is crucial for energy production and utilization in cells . Through this antiporter function, SLC25A5 helps maintain the mitochondrial membrane potential by regulating ADP/ATP ratios during oxidative phosphorylation . Beyond its primary role in energy metabolism, SLC25A5 may also participate in the mitotic spindle-associated MMXD complex, potentially playing a role in chromosome segregation during cell division .

Protein Structure

The bovine ADP/ATP translocase 2 protein consists of approximately 297-298 amino acid residues . It forms a homodimeric structure that embeds within the inner mitochondrial membrane . The protein's architecture features six transmembrane helices that create a channel through which adenine nucleotides are transported . This structural arrangement is critical for its function as an antiporter, allowing it to facilitate the directional exchange of ADP and ATP molecules.

Genetic Organization and Variants

The bovine genome contains multiple genes encoding ADP/ATP translocase proteins. Research has identified two distinct bovine cDNAs that encode closely related homologues of this mitochondrial membrane carrier protein . These two variants differ in 33 amino acids out of a total of 297, with the coding regions of their respective cDNAs differing at 184 positions .

Additionally, these variants exhibit extensive divergence in their 3' noncoding sequences, which vary significantly in both length and sequence composition . This genetic diversity likely reflects the differential expression and specialized functions of these variants across various bovine tissues.

The table below summarizes the key molecular characteristics of bovine ADP/ATP translocase 2:

CharacteristicDescription
Protein Length297-298 amino acids
StructureHomodimer with six transmembrane helices
Genetic VariantsTwo distinct cDNAs identified in bovine tissues
Sequence Variation33 amino acid differences between variants (out of 297)
UniProt IdentifierQ8SQH5
FunctionCatalyzes exchange of cytoplasmic ADP with mitochondrial ATP

Tissue-Specific Expression Patterns

The expression of ADP/ATP translocase genes varies significantly across different bovine tissues, suggesting tissue-specific functions and metabolic requirements. Research utilizing hybridization probes derived from the 3' noncoding sequences of the different translocase cDNAs has demonstrated that the expression of the two genes giving rise to the different protein variants is highly tissue-dependent .

One gene variant predominates in heart muscle, reflecting the high energy demands of cardiac tissue, while the other is more abundantly expressed in intestinal tissue . This differential expression pattern suggests that these variants may have evolved specialized functions to accommodate the unique metabolic requirements of different tissues.

Expression Systems and Purification

Recombinant bovine ADP/ATP translocase 2 protein is typically produced using bacterial expression systems. According to available information, the recombinant full-length bovine ADP/ATP translocase 2 protein (amino acids 2-298) can be successfully expressed in E. coli with an N-terminal His-tag to facilitate purification . This approach enables the production of sufficient quantities of the protein for various research applications, including structural studies, functional analyses, and antibody production.

Characteristics of Recombinant Protein

The recombinant protein typically includes the functional domains of the native protein (amino acids 2-298) and often features an N-terminal histidine tag to facilitate purification by affinity chromatography . This recombinant version retains the structural features necessary for studying the protein's function and interactions, while the His-tag enables efficient isolation of the protein from bacterial lysates.

ELISA-Based Quantification

The development of specialized immunoassay kits, such as the Bovine ADP/ATP Translocase 2 (SLC25A5) ELISA Kit, has enabled researchers to accurately quantify ADP/ATP translocase 2 levels in bovine samples . These kits offer high sensitivity and specificity, providing precise and consistent results for various research applications. They can be used with multiple sample types, including serum, plasma, tissue homogenates, cell culture supernatants, and other biological fluids .

The technical specifications of a typical ELISA kit for bovine SLC25A5 include:

ParameterSpecification
TargetBovine ADP/ATP translocase 2 (SLC25A5)
Detection MethodELISA
ReactivityBovine
Sample TypesSerum, plasma, tissue homogenates, cell culture supernatants, biological fluids
SpecificityNatural and recombinant bovine ADP/ATP translocase 2

Functional Studies

Recombinant bovine ADP/ATP translocase 2 has proven invaluable for functional studies investigating the protein's role in mitochondrial energy metabolism. By using recombinant proteins, researchers can perform detailed biochemical analyses, protein-protein interaction studies, and structural investigations to better understand the molecular mechanisms underlying the translocase's function.

Role in Cancer Biology

Functional studies in colon cancer-derived cell lines have demonstrated that SLC25A5 attenuates cell proliferation, upregulates the expression of programmed cell death-related signatures, and exerts its biological function by inhibiting the MAPK signaling pathway . These findings highlight the potential of SLC25A5 as both a prognostic biomarker and a potential therapeutic target in cancer.

Metabolic and Neurodegenerative Disorders

Dysregulation of SLC25A5 has been implicated in various diseases beyond cancer, including metabolic disorders and neurodegenerative conditions . Given its fundamental role in mitochondrial energy metabolism, alterations in SLC25A5 function can have far-reaching consequences for cellular health and function. This makes it a protein of interest for understanding the pathophysiology of mitochondrial dysfunction-related diseases and for developing targeted therapeutic interventions.

Evolutionary Relationship to Other Mitochondrial Carriers

The ADP/ATP translocase belongs to a family of structurally related mitochondrial carrier proteins. Sequence comparisons have revealed that the mitochondrial phosphate carrier protein, ADP/ATP translocase, and the uncoupling protein from brown fat mitochondria all contain a 3-fold repeated sequence approximately 100 amino acids in length . The repeats in these three proteins are related to each other, suggesting they share common three-dimensional structures, mechanisms, and evolutionary origins .

Analysis of the distribution of hydrophobic residues suggests that each repeated 100 amino acid element comprises two membrane-spanning α-helices linked by an extensive hydrophilic domain . This structural model provides insights into how these proteins function within the mitochondrial membrane and how they have evolved to perform specialized transport functions.

Future Research Directions

Research on recombinant bovine ADP/ATP translocase 2 continues to evolve, with several promising directions for future investigation:

  1. Detailed structural studies using advanced techniques such as cryo-electron microscopy could provide deeper insights into the protein's transport mechanism.

  2. Investigation of tissue-specific functions of different translocase variants could reveal specialized roles in different metabolic contexts.

  3. Exploration of the protein's potential as a therapeutic target in cancer and other diseases could lead to novel treatment strategies.

  4. Development of small-molecule modulators of translocase activity could provide valuable tools for both research and potential therapeutic applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet your needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your requirements; we will prioritize your specified tag type.
Synonyms
SLC25A5; ANT2; ADP/ATP translocase 2; ADP,ATP carrier protein 2; Adenine nucleotide translocator 2; ANT 2; Solute carrier family 25 member 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-298
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
TDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRI PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIRGLYQGFNVSV QGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQ SGRKGTDIMYTGTLDCWRKIARDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKFT
Uniprot No.

Target Background

Function
ADP/ATP translocase 2 (SLC25A5) is an inner mitochondrial membrane antiporter that facilitates the exchange of ADP and ATP across the mitochondrial membrane, crucial for ATP synthesis and cellular energy supply. It operates via an alternating access mechanism, cycling between cytoplasmic- and matrix-open states. Beyond its primary ADP/ATP exchange function, SLC25A5 also contributes to mitochondrial uncoupling and permeability transition pore (mPTP) activity. It acts as a proton transporter, uncoupling oxidative phosphorylation and promoting thermogenesis, a process modulated by its ADP/ATP antiporter activity. This suggests SLC25A5 plays a central regulatory role in balancing ATP production and thermogenesis. Free fatty acids are required as cofactors for its proton transport activity. SLC25A5 is implicated in mPTP opening, although its precise role as a pore-forming component or regulator remains unclear. Importantly, SLC25A5 also regulates mitophagy independent of its ADP/ATP antiporter function, promoting mitophagy through interaction with TIMM44 and subsequent inhibition of TIMM23, stabilizing PINK1. As a component of the mitotic spindle-associated MMXD complex, SLC25A5 may also participate in chromosome segregation.
Database Links

KEGG: bta:282479

STRING: 9913.ENSBTAP00000056626

UniGene: Bt.9559

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of bovine ADP/ATP translocase 2 (SLC25A5)?

ADP/ATP translocase 2 (SLC25A5) is a mitochondrial membrane carrier protein that facilitates the exchange of cytoplasmic ADP with mitochondrial ATP across the inner mitochondrial membrane. The protein has a molecular mass of approximately 32 kDa and consists of 298 amino acids in humans . Structurally, SLC25A5 belongs to the mitochondrial carrier family (TC 2.A.29) and contains six transmembrane α-helical spanners .

The protein cycles between two distinct conformational states: a cytoplasmic-open state (c-state) and a matrix-open state (m-state). In the m-state, the central cavity is open to the mitochondrial matrix side, with the matrix helices rotated outward, while the cavity is closed to the cytoplasmic side by a cluster of residues including those of the cytoplasmic salt bridge network. Conversely, in the c-state, the cytoplasmic network residues are far apart, and the matrix salt bridge network residues interact to close the carrier on the matrix side .

SLC25A5 functions primarily as an antiporter, exchanging ADP for ATP across the mitochondrial inner membrane. This exchange is crucial for maintaining cellular energy homeostasis, as it allows ATP produced by oxidative phosphorylation to exit the mitochondria for use in cellular processes while simultaneously importing ADP for continued ATP synthesis .

How does SLC25A5 differ structurally from other mitochondrial carrier proteins?

SLC25A5 shares structural similarities with other mitochondrial carrier proteins such as the phosphate carrier protein and the brown fat mitochondria uncoupling protein. All three proteins contain a 3-fold repeated sequence structure, which has been identified through sequence comparison analyses .

Protein FeatureSLC25A5 (ADP/ATP Translocase)Phosphate CarrierUncoupling Protein
Repeating Units3-fold repeated sequence3-fold repeated sequence3-fold repeated sequence
Conserved Areasα-helical segments, loop connectionsα-helical segments, loop connectionsα-helical segments, loop connections
Divergent AreasCentral parts of loops, N/C terminalsCentral parts of loops, N/C terminalsCentral parts of loops, N/C terminals
SubstrateADP/ATPPhosphateProtons
Main FunctionEnergy exchangePhosphate transportHeat generation

This structural comparison reveals how evolutionary conservation of the core transport mechanism exists alongside functional specialization for different metabolites and roles in mitochondrial metabolism .

What genomic diversity exists for bovine ADP/ATP translocase 2?

Research has identified two different bovine cDNAs encoding closely related homologues of ADP/ATP translocase. One codes for the protein previously characterized from bovine heart mitochondria, while the other encodes a protein that differs in 33 amino acids out of 297 . The coding regions of these cDNAs differ at 184 positions, and they show extensive divergence in their 3' noncoding sequences, which differ significantly in both length and sequence .

Expression of these two genes varies across different bovine tissues, with one gene predominating in heart muscle and the other in intestine . This tissue-specific expression pattern suggests specialized roles for these isoforms in different tissues, potentially adapting to varying metabolic demands.

Hybridization experiments with genomic DNA digests have revealed numerous sequences related to these two cDNAs in both bovine and human genomes. While some of these sequences likely represent pseudogenes, three expressed genes have been detected in the human genome . This genetic diversity suggests a complex evolutionary history for ADP/ATP translocase genes and may reflect functional adaptations to different cellular and tissue environments.

How do conformational changes in bovine SLC25A5 mediate substrate transport?

The transport mechanism of bovine SLC25A5 involves significant conformational changes that alternate the accessibility of the central cavity between the cytoplasmic and matrix sides of the mitochondrial inner membrane. X-ray crystallography and computational modeling have revealed that the transporter undergoes a profound conformational change between the cytoplasmic-open (c-state) and matrix-open (m-state) conformations .

In the BKA-inhibited m-state, the central cavity is open to the mitochondrial matrix side, with matrix helices rotated outward. This conformation is closed to the cytoplasmic side by a cluster of residues including those of the cytoplasmic salt bridge network. Mutations of key residues in this network have demonstrated that the strongest links in the cytoplasmic network have the largest effects on transport and thermal stability .

Conversely, in the c-state, the cytoplasmic network residues are far apart, while the matrix salt bridge network residues interact to close the carrier on the matrix side. This alternating access mechanism enables the selective transport of ADP and ATP in opposite directions across the membrane .

The significance of specific residues in this conformational switching has been demonstrated through mutagenesis studies. Random mutagenesis of the related ScAac2 has produced yeast strains resistant to the inhibitor bongkrekic acid (BKA) while maintaining carrier functionality. Three of the four identified mutations were within the observed BKA-binding site (Y97C, L142S, and G298S, equivalent to Y89, L135, and G291 in TtAac), demonstrating the importance of these residues in inhibitor binding without affecting the key substrate-binding residues .

What is the relationship between SLC25A5 expression and cellular metabolic states?

SLC25A5 expression is tightly regulated according to cellular metabolic demands and proliferation status. The protein is primarily expressed in proliferative and undifferentiated cells, and its expression is activated during cell proliferation but repressed when cells become growth-arrested . This expression pattern reflects the increased energy demands of rapidly dividing cells compared to quiescent cells.

Research has also demonstrated that SLC25A5 expression serves as an important indicator of carcinogenesis, as it relates directly to the rate of glycolytic metabolism . Cancer cells typically exhibit altered metabolism, often characterized by increased glycolysis even in the presence of oxygen (the Warburg effect), and changes in SLC25A5 expression may contribute to or reflect these metabolic adaptations.

SLC25A5 functions in concert with other mitochondrial proteins to maintain energy homeostasis. Compared with F1F0-ATPase, SLC25A5 has the opposite effect in the mitochondrial matrix, but together these proteins maintain the mitochondrial membrane potential and ensure cell survival and proliferation .

How do tissue-specific isoforms of ADP/ATP translocase differ in function and regulation?

Tissue-specific expression of different ADP/ATP translocase isoforms suggests functional specialization adapted to the metabolic requirements of different tissues. Research has demonstrated that one gene for bovine ADP/ATP translocase predominates in heart muscle, while another is more highly expressed in intestine . This differential expression likely reflects the distinct energy demands and metabolic profiles of these tissues.

The functional implications of these tissue-specific expression patterns may relate to differences in:

  • ATP/ADP exchange rates optimized for tissue-specific energy demands

  • Regulatory mechanisms responding to different metabolic signals

  • Interactions with tissue-specific protein partners

  • Responses to hormonal and neuronal regulation

  • Adaptations to oxidative stress and other cellular challenges

The existence of multiple isoforms with tissue-specific expression patterns also has implications for understanding human mitochondrial diseases. Research suggests that defects in mitochondrial enzymes may manifest in a tissue-specific manner, affecting only certain tissues despite the ubiquitous presence of mitochondria . The study of the regulation of ADP/ATP translocase gene expression may therefore provide insights into the basis of these tissue-specific mitochondrial diseases.

What expression systems are optimal for producing recombinant bovine SLC25A5?

The production of recombinant bovine SLC25A5 requires careful consideration of expression systems that can properly fold and insert this multi-pass membrane protein into a lipid bilayer while maintaining its functional characteristics. Several expression systems have been successfully employed for mitochondrial carrier proteins:

Expression SystemAdvantagesLimitationsSuitable Applications
E. coliHigh yield, rapid growth, cost-effectiveMay form inclusion bodies requiring refolding, lacks post-translational modificationsStructural studies, antibody production
Yeast (S. cerevisiae)Eukaryotic folding machinery, relatively high yieldMay have different lipid composition affecting functionFunctional studies, complementation assays
Insect cellsAdvanced post-translational modifications, membrane integrationHigher cost, longer production timeFunctional studies, protein-protein interactions
Mammalian cellsMost native-like environment, proper foldingLowest yield, highest costDetailed functional studies, trafficking studies

For structural studies of bovine SLC25A5, bacterial expression followed by solubilization in appropriate detergents has been successful . When examining functional aspects, yeast expression systems can be particularly valuable as they allow for complementation studies in strains lacking endogenous ADP/ATP translocase activity.

The choice of purification strategy also requires careful consideration. Affinity tags (e.g., His-tag, FLAG-tag) are commonly used but must be positioned to avoid interference with protein folding or function. For bovine SLC25A5, C-terminal tags are often preferred as they minimize disruption of the N-terminal region involved in protein insertion into the membrane.

Detergent selection for membrane protein solubilization is critical, with mild detergents like DDM (n-dodecyl β-D-maltoside) and digitonin proving effective for maintaining the native structure of mitochondrial carrier proteins. For reconstitution studies, liposomes with a lipid composition mimicking the mitochondrial inner membrane provide the most physiologically relevant environment for functional assays .

What assays can measure the transport activity of recombinant SLC25A5?

Assessing the transport activity of recombinant bovine SLC25A5 requires specialized techniques that can monitor the exchange of adenine nucleotides across a membrane barrier. Several complementary approaches are available:

  • Liposome-based transport assays: SLC25A5 can be reconstituted into liposomes preloaded with radiolabeled or fluorescently labeled substrates. The rate of exchange between internal and external compartments can be measured by monitoring the appearance or disappearance of labeled substrates over time. This approach provides direct quantification of transport kinetics.

  • Mitochondrial swelling assays: Changes in mitochondrial volume upon substrate transport can be monitored spectrophotometrically. This technique measures the osmotic consequences of substrate transport but requires careful interpretation.

  • Patch-clamp electrophysiology: For detailed kinetic analyses, patch-clamp techniques applied to mitochondrial membranes or reconstituted systems can measure the electrical currents associated with the electrogenic exchange of ATP4- for ADP3-.

  • Fluorescence-based assays: Membrane potential-sensitive dyes or genetically encoded sensors can indirectly monitor ATP/ADP exchange by detecting changes in mitochondrial membrane potential.

  • Isothermal titration calorimetry (ITC): This approach can measure the thermodynamics of substrate binding, providing insights into the affinity and energetics of interactions between SLC25A5 and its substrates.

Transport assays should include appropriate controls, such as:

  • Specific inhibitors (e.g., carboxyatractyloside or bongkrekic acid) to confirm SLC25A5-mediated transport

  • Empty liposomes or membranes to account for non-specific permeability

  • Heat-inactivated protein to establish baseline activity

  • Competing substrates to assess transport specificity

When analyzing data from transport assays, researchers should consider factors such as protein orientation in the membrane, potential rate-limiting steps (binding versus translocation), and the influence of membrane composition on transport activity .

How can mutagenesis studies reveal structure-function relationships in SLC25A5?

Mutagenesis studies have been instrumental in elucidating the structure-function relationships in bovine SLC25A5 and related ADP/ATP translocases. These approaches can systematically probe the roles of specific residues in substrate binding, conformational changes, and inhibitor interactions.

Site-directed mutagenesis targeting conserved residues in the proposed transmembrane regions has revealed key amino acids involved in substrate selectivity and transport. For example, mutations of the strongest links in the cytoplasmic network have demonstrated the largest effects upon transport and thermal stability, as expected from the structure of the cytoplasmic network in the m-state .

Random mutagenesis approaches have also yielded valuable insights. Studies of the yeast homolog ScAac2 identified mutations (Y97C, L142S, and G298S, equivalent to Y89, L135, and G291 in TtAac) that confer resistance to the inhibitor bongkrekic acid (BKA) while maintaining carrier functionality . These mutations are located within the observed BKA-binding site, confirming the binding pose determined by structural studies.

A systematic mutagenesis strategy might include:

  • Alanine scanning mutagenesis: Replacing each residue systematically with alanine to identify essential amino acids

  • Conservative substitutions: Replacing residues with chemically similar amino acids to probe the importance of specific chemical properties

  • Charge-reversal mutations: Changing charged residues to oppositely charged ones to assess electrostatic interactions

  • Cysteine scanning and crosslinking: Introducing cysteine residues at specific positions to probe accessibility and proximity relationships

  • Chimeric constructs: Creating hybrid proteins between different isoforms or related carriers to map functional domains

When conducting mutagenesis studies, researchers should assess multiple functional parameters, including transport activity, substrate binding affinity, inhibitor sensitivity, and protein stability. Complementary structural analyses using techniques such as hydrogen/deuterium exchange mass spectrometry or electron paramagnetic resonance spectroscopy can provide additional insights into how mutations affect protein dynamics and conformation .

How does SLC25A5 function relate to mitochondrial diseases and potential therapeutics?

SLC25A5's central role in cellular energy metabolism makes it a critical factor in mitochondrial diseases and a potential target for therapeutic interventions. As the primary mediator of ADP/ATP exchange across the mitochondrial inner membrane, dysfunction in SLC25A5 can severely impact cellular energy homeostasis.

Studies have shown that the regulation of ADP/ATP translocase gene expression may provide insights into tissue-specific human mitochondrial diseases . Despite the ubiquitous presence of mitochondria in human cells, defects in mitochondrial enzymes often manifest in a tissue-specific manner, affecting only certain tissues. This tissue specificity may relate to the differential expression of ADP/ATP translocase isoforms across tissues, with one gene predominating in heart muscle and another in intestine .

Potential therapeutic strategies targeting SLC25A5 could include:

  • Gene therapy approaches: Delivering functional copies of SLC25A5 to tissues with deficient activity

  • Small molecule modulators: Developing compounds that enhance the transport activity of partially functional SLC25A5 variants

  • Metabolic bypass strategies: Implementing alternative pathways for ATP delivery to affected tissues

  • Tissue-specific targeting: Designing interventions that account for tissue-specific isoform expression and regulation

Research on inhibitors such as bongkrekic acid (BKA) has provided valuable insights into the structure and function of ADP/ATP translocases . These inhibitors could serve as templates for developing more selective therapeutic compounds that modulate SLC25A5 activity in specific disease contexts.

It's worth noting that SLC25A5 also participates in the formation of the mitochondrial permeability transition pore (MPTP), which plays a crucial role in cell death pathways. This involvement suggests potential applications in cancer therapy, where modulating SLC25A5 function could sensitize cancer cells to apoptotic stimuli.

What is the role of SLC25A5 in cancer metabolism and as a potential therapeutic target?

High SLC25A5 expression has been demonstrated to be an independent prognostic factor for patients after surgical treatment . Mechanistically, SLC25A5 appears to attenuate cell proliferation, upregulate the expression of programmed cell death-related signatures, and exert its biological function by inhibiting the MAPK signaling pathway .

The expression of SLC25A5 is considered an important index of carcinogenesis because it relates directly to the rate of glycolytic metabolism . Cancer cells typically exhibit altered metabolism, often characterized by increased glycolysis even in the presence of oxygen (the Warburg effect), and changes in SLC25A5 expression may contribute to or reflect these metabolic adaptations.

AspectSLC25A5 in Normal CellsSLC25A5 in Cancer CellsTherapeutic Implications
ExpressionActivated during proliferationOften downregulatedPotential biomarker for diagnosis and prognosis
Metabolic ImpactSupports normal ATP/ADP exchangeMay contribute to altered metabolismTarget for metabolic reprogramming strategies
SignalingNormal MAPK regulationMay lose inhibitory effect on MAPKCombined targeting with MAPK pathway inhibitors
Cell DeathSupports normal apoptotic potentialMay be altered, affecting cell death resistanceSensitizer for apoptosis-inducing therapies
Immune InteractionNegative correlation with CD8 in some contextsMay influence tumor immune environmentPotential combination with immunotherapies

Research has identified a negative correlation between CD8 and SLC25A5 in specimens from patients with advanced colon cancer , suggesting complex interactions between SLC25A5 expression and the tumor immune microenvironment. These findings highlight the potential for combining SLC25A5-targeted therapies with immunotherapeutic approaches.

Developing therapeutic strategies targeting SLC25A5 in cancer would require careful consideration of:

  • Tissue-specific expression patterns and isoform diversity

  • Effects on non-cancerous cells with high energy demands

  • Compensatory mechanisms that might emerge upon targeting

  • Delivery methods to reach mitochondria within cancer cells

How can structural insights into SLC25A5 inform drug design for mitochondrial disorders?

Structural insights into bovine SLC25A5 provide valuable guidance for rational drug design targeting mitochondrial disorders. The elucidation of the protein's conformational states and key functional residues offers multiple strategies for therapeutic intervention.

The alternating access mechanism of SLC25A5, involving transitions between cytoplasmic-open (c-state) and matrix-open (m-state) conformations, presents opportunities for designing conformation-specific modulators . Compounds that stabilize particular conformational states could either enhance or inhibit transport activity depending on the therapeutic goal.

Structural studies have identified the binding site for the inhibitor bongkrekic acid (BKA), revealing key residues involved in inhibitor interactions . Mutations at positions Y97C, L142S, and G298S (equivalent to Y89, L135, and G291 in TtAac) confer resistance to BKA while maintaining carrier functionality. These residues are in van der Waals contact with BKA, and the Y97C mutation would remove a hydrogen bond to BKA . This detailed understanding of inhibitor binding can guide the design of more selective compounds with optimized pharmacological properties.

Structure-based drug design approaches for SLC25A5 might include:

  • Fragment-based screening: Identifying small chemical fragments that bind to specific pockets within the protein structure

  • Virtual screening: Computational screening of compound libraries against the solved protein structure

  • Structure-activity relationship studies: Systematic modification of lead compounds to optimize binding and selectivity

  • Allosteric modulators: Designing compounds that bind outside the substrate-binding site to modulate protein function

  • Covalent inhibitors: Developing compounds that form covalent bonds with specific residues unique to particular conformational states

The comparative analysis of SLC25A5 with other mitochondrial carrier proteins reveals conserved and divergent structural elements . Targeting the divergent regions, which likely contribute to carrier specificity, could enable selective modulation of SLC25A5 without affecting related transporters.

For mitochondrial disorders characterized by defects in energy metabolism, compounds that enhance the efficiency of ADP/ATP exchange could potentially compensate for other mitochondrial deficiencies. Conversely, in conditions where excessive mitochondrial activity contributes to pathology (e.g., certain neurodegenerative diseases), selective inhibitors of SLC25A5 might offer therapeutic benefits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.