Recombinant Bovine Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A (MGAT4A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for accurate delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MGAT4A; Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa; GlcNAc-T IVa; GnT-IVa; N-acetylglucosaminyltransferase IVa; UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-535
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
MGAT4A
Target Protein Sequence
MRLRNGTVATVLAFITSFLTLSWYTTWQNGKEKVIAYQREFLALKERLRIAEHRISQRSSELSAIVQQFKRVEAETNRSKDPVNKFSDDTLKILKELTSKKSLQVPSIYYHLPHLLQNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDTDYVNGVVANLEKEFSKEISSGLVEIISPPESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQEKGTYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLTGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPVAGDYILFKFDKPVNVESYLFHSGNQDHPGDILLNTTVEVLPLKSEGLDISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKVTN
Uniprot No.

Target Background

Function
This glycosyltransferase plays a crucial role in transferring N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. It specifically catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. MGAT4A is essential for the production of tri- and tetra-antennary N-linked sugar chains and is involved in glucose transport by mediating SLC2A2/GLUT2 glycosylation, thus controlling cell-surface expression of SLC2A2 in pancreatic beta cells.
Database Links

KEGG: bta:282276

STRING: 9913.ENSBTAP00000013715

UniGene: Bt.193

Protein Families
Glycosyltransferase 54 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein. Secreted. Note=A processed soluble form also exists.
Tissue Specificity
Highly expressed in small intestine, kidney, lung and spleen. Weakly expressed in brain, heart and liver.

Q&A

What is the enzymatic function of MGAT4A?

MGAT4A, also known as GnT-IVa, is a metal-dependent Golgi single-pass type II membrane protein that catalyzes a specific glycosyltransferase reaction. It transfers N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to form a beta-1,4 linkage to the Man-alpha-1,3-Man-beta-1,4-GlcNAc arm of specific N-glycans . The precise reaction catalyzed is: UDP-N-acetyl-D-glucosamine + 3-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R = UDP + 3-(2,4-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R . This enzymatic activity is essential for the formation of tri- and tetra-antennary N-glycan structures, which are crucial for proper glycoprotein function in various biological processes .

What is the tissue distribution pattern of MGAT4A expression?

MGAT4A displays a distinctive tissue distribution pattern with particularly high expression in gastrointestinal tissues, especially the pancreas . While the enzyme is detected in various human tissues, expression levels of MGAT4A mRNA vary significantly across tissue types. Highest mRNA levels have been observed in spleen, thymus, peripheral blood leukocyte, lymph node, prostate, pancreas, and small intestine . In disease states such as cancer, aberrant expression patterns have been reported across various cell lines, with notably high expression in promyelocytic leukemia cell line HL-60 and lymphoblastic leukemia cell line MOLT-4 . Understanding tissue-specific expression patterns is crucial for investigating MGAT4A's role in tissue-specific pathologies.

How can MGAT4A enzymatic activity be measured in vitro?

MGAT4A activity can be effectively measured using a fluorescent gel shift assay. This methodology involves:

  • Preparation of recombinant MGAT4A protein (e.g., diluted to 50 μg/mL in appropriate assay buffer)

  • Creating a reaction mix containing 0.02 μM Cy5-Fuc labeled N2f (Cy5-N2f) and 1 mM UDP-GlcNAc in assay buffer

  • Combining protein solution with reaction mix (typically 10 μL each)

  • Incubating at 37°C for 60 minutes

  • Adding gel loading dye and resolving on a 17% SDS-PAGE gel

  • Imaging the gel using a Cy5 fluorescent dye detection system

  • Quantifying percent conversion of the substrate

The activity is determined by observing a mobility shift in the glycan substrate following successful GlcNAc transfer. This approach allows for quantitative assessment of MGAT4A catalytic efficiency and can be used to evaluate factors affecting enzyme function.

What methods are available for detecting and quantifying bovine MGAT4A protein?

Several complementary approaches can be employed for detecting and quantifying bovine MGAT4A:

MethodApplicationSensitivityAdvantagesLimitations
ELISAQuantitative detection in biological samplesHigh (pg/mL range)High-throughput, specific quantificationRequires validated antibodies
Western BlottingProtein expression analysisModerateSize verification, semi-quantitativeLower throughput, less quantitative
SDS-PAGEPurity assessmentModerateSimple, widely accessibleNon-specific, requires staining
Mass SpectrometryProtein identification, PTM analysisVery highDetailed structural informationComplex sample preparation, expensive equipment

For research applications, sandwich ELISA assays provide reliable quantification of bovine MGAT4A. These assays typically involve an antibody specific for MGAT4A pre-coated onto a microplate, followed by sample addition, detection with a biotin-conjugated antibody, and signal development using streptavidin-HRP conjugate . When selecting detection methods, researchers should consider the required sensitivity, sample type, and available equipment.

How should recombinant MGAT4A be stored and handled to maintain activity?

Proper storage and handling of recombinant MGAT4A is critical for maintaining enzymatic activity. Based on standard protocols for glycosyltransferases:

  • Storage temperature: Store lyophilized protein at -20°C and reconstituted protein at -80°C

  • Reconstitution: Use sterile, buffer-appropriate conditions (typically phosphate or Tris buffer with stabilizing agents)

  • Aliquoting: Prepare single-use aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce activity

  • Buffer considerations: Include metal cofactors (often Mn²⁺) for optimal activity

  • Stability enhancers: Consider adding glycerol (10-20%) to prevent freeze-thaw damage

  • Temperature sensitivity: Avoid extended periods at room temperature

  • Protection from proteases: Include protease inhibitors when working with complex biological samples

When conducting enzymatic assays, maintain temperature control and precise timing to ensure reproducible results. Enzyme activity should be validated periodically using standardized activity assays, particularly when working with new protein preparations.

How does MGAT4A contribute to type 2 diabetes pathogenesis?

MGAT4A plays a critical role in glucose homeostasis and type 2 diabetes pathogenesis through its effects on GLUT2 glycosylation in pancreatic β-cells. Research using knockout mouse models has revealed several key mechanisms:

  • Mgat4a-deficient mice spontaneously develop diabetic phenotypes, including elevated body weight, increased blood glucose levels, and impaired insulin secretion

  • MGAT4A modifies the N-glycans on glucose transporter 2 (GLUT2), which is essential for both glucose sensing and insulin secretion in β-cells

  • Proper glycosylation of GLUT2 by MGAT4A is required for efficient interaction between GLUT2 and galectins at the cell surface

  • These interactions prolong the cell surface residency of GLUT2, enhancing its glucose-sensing function

  • In the absence of MGAT4A, abnormally enhanced endocytosis of GLUT2 occurs, reducing glucose sensing capability

  • High-fat diet consumption in mice causes transcriptional downregulation of Mgat4a, contributing to diabetic phenotypes

  • Importantly, mRNA levels of human MGAT4A are reduced in pancreatic beta cells from diabetes patients

These findings indicate that MGAT4A-mediated glycosylation represents a crucial regulatory mechanism in glucose homeostasis and suggest potential therapeutic approaches targeting this pathway for diabetes management.

What is known about MGAT4A's role in cancer progression?

MGAT4A has emerging significance in cancer biology through its ability to modify glycoproteins involved in cellular adhesion, migration, and signaling. Several lines of evidence implicate MGAT4A in oncogenesis:

  • Aberrant expression of MGAT4A mRNA has been documented in various cancer cell lines, including promyelocytic leukemia (HL-60) and lymphoblastic leukemia (MOLT-4)

  • MGAT4A has been shown to promote cancer cell invasiveness by modulating the functions of key glycoproteins, including integrin β1

  • The enzyme's role in N-glycan branching can alter cell surface receptor clustering, modifying signal transduction pathways that regulate cell growth and survival

  • Altered expression has been observed in choriocarcinoma, invasive mole, and placental site trophoblastic tumors

  • Changed glycosylation patterns resulting from aberrant MGAT4A activity may contribute to immune evasion mechanisms in tumors

How can MGAT4A be utilized for glycoengineering of complex N-glycans?

MGAT4A offers significant potential for the glycoengineering of complex N-glycans in research and biotherapeutic applications. A methodological approach to utilizing MGAT4A for glycoengineering includes:

  • Expression and purification of recombinant MGAT4A (with appropriate tags for purification and activity)

  • Characterization of substrate specificity using glycan microarrays or MS-based approaches

  • Optimization of reaction conditions (pH, temperature, cofactors) for specific target glycans

  • Sequential enzymatic remodeling approaches:

    • Initial trimming of existing glycans using exoglycosidases

    • MGAT4A-mediated addition of β1,4-GlcNAc to create branched structures

    • Further modification using additional glycosyltransferases

  • Verification of glycan structures using:

    • Mass spectrometry (MALDI-TOF, LC-MS/MS)

    • NMR spectroscopy for detailed structural analysis

    • Lectin binding assays for specific glycan epitope confirmation

The ability of MGAT4A to create tri- and tetra-antennary N-glycans makes it particularly valuable for engineering glycans with enhanced complexity, which can be applied to improve therapeutic protein properties, including half-life, targeting, and immunogenicity profiles.

What experimental designs are most effective for studying MGAT4A function in vivo?

Effective experimental designs for studying MGAT4A function in vivo require integrated approaches across molecular, cellular, and physiological levels:

ApproachMethodologyApplicationsKey Considerations
Genetic ModelsKnockout/knockdown mice, Transgenic overexpression, Tissue-specific expressionSystemic effects, Developmental roles, Disease modelingCompensatory mechanisms, Developmental effects
Diet-Induced ModelsHigh-fat diet, Metabolic challenge testsType 2 diabetes studies, Metabolic regulationStrain differences, Diet composition standardization
Ex Vivo Tissue AnalysisPancreatic islet isolation, Glucose-stimulated insulin secretionβ-cell function assessmentTissue viability, Rapid processing requirements
GlycoproteomicsMS-based glycan analysis, Site-specific glycosylation profilingIdentifying MGAT4A targetsComplex data analysis, Reference databases
Cellular TraffickingLive-cell imaging, Surface biotinylationGLUT2 endocytosis studiesRequires specialized equipment, Complex data interpretation

The most robust study designs incorporate multiple complementary approaches. For example, combining Mgat4a knockout models with glycoproteomic analysis and functional metabolic testing can provide comprehensive insights into MGAT4A's physiological roles. Additionally, rescue experiments using recombinant MGAT4A can help establish causal relationships between specific glycosylation events and observed phenotypes.

How do changes in MGAT4A expression affect global glycosylation patterns?

Changes in MGAT4A expression can have profound effects on global N-glycan profiles through alterations in branching patterns. Methodologically, these effects can be investigated through:

  • Comparative Glycomics Analysis: Using techniques such as HILIC-UPLC, MALDI-TOF-MS, or LC-MS/MS to characterize the N-glycome in wild-type versus MGAT4A-modified systems

  • Glycoproteomics Workflows: Combining enrichment strategies (lectin affinity, hydrazide chemistry) with MS analysis to identify specific glycoproteins affected by MGAT4A modulation

  • Lectin Microarrays: Providing a high-throughput assessment of glycan epitope changes associated with MGAT4A expression alterations

  • Functional Glycomics: Correlating glycan structural changes with alterations in protein-glycan interactions, particularly galectin binding

When MGAT4A expression is reduced, expected changes include:

  • Decreased tri- and tetra-antennary N-glycans

  • Increased bi-antennary structures

  • Altered terminal modifications due to changes in substrate availability for terminal glycosyltransferases

  • Modified galectin lattice formation affecting cell surface receptor organization

These glycosylation changes can significantly impact cellular functions through altered receptor clustering, signaling pathway activation, and protein stability. Comprehensive glycomic analysis is essential for interpreting the functional consequences of MGAT4A-mediated glycosylation in both normal physiology and disease states.

What approaches show promise for modulating MGAT4A activity for therapeutic purposes?

Several promising approaches for modulating MGAT4A activity are under investigation for therapeutic applications:

  • Small Molecule Inhibitors/Activators:

    • Nucleotide sugar analogs that compete with UDP-GlcNAc

    • Allosteric modulators targeting the carbohydrate binding module

    • Structure-based drug design targeting the catalytic domain

  • Gene Therapy Approaches:

    • Viral vector-mediated delivery of MGAT4A for expression restoration

    • CRISPR-Cas9 based modulation of MGAT4A expression

    • Promoter-targeting approaches to enhance endogenous expression

  • RNA-Based Therapeutics:

    • siRNA for targeted knockdown in overexpression scenarios

    • mRNA delivery for temporary expression enhancement

    • Antisense oligonucleotides targeting splicing regulation

  • Metabolic Approaches:

    • Dietary interventions affecting UDP-GlcNAc availability

    • Upstream metabolic pathway modulation

The selection of appropriate therapeutic strategies depends on whether enhancement or inhibition of MGAT4A activity is desired for a particular condition. For type 2 diabetes, where reduced MGAT4A activity contributes to pathology, approaches to increase expression or activity would be beneficial . Conversely, in cancer contexts where MGAT4A may promote invasiveness, inhibitory strategies might be preferred .

How can researchers design experiments to identify and validate MGAT4A modulators?

A systematic approach to identifying and validating MGAT4A modulators includes:

  • Primary Screening Assays:

    • Fluorescence-based enzyme activity assays using purified recombinant MGAT4A

    • High-throughput screening using Cy5-labeled glycan substrates and gel shift detection

    • Cell-based reporter systems reflecting MGAT4A activity

  • Secondary Validation Assays:

    • Dose-response characterization

    • Specificity testing against related glycosyltransferases

    • Mode of action studies (competitive vs. non-competitive)

    • Binding affinity measurements using surface plasmon resonance or isothermal titration calorimetry

  • Cellular Activity Validation:

    • Effects on glycan profiles in relevant cell lines

    • Functional consequences on GLUT2 trafficking in pancreatic β-cells

    • Cell viability and toxicity assessment

  • In Vivo Validation:

    • Pharmacokinetic and pharmacodynamic studies

    • Efficacy testing in disease models (diabetes, cancer)

    • Biomarker development for target engagement

When designing screening cascades, researchers should consider the translation potential by incorporating clinically relevant readouts early in the validation process. For diabetes applications, assessing effects on insulin secretion and glucose uptake provides functionally relevant endpoints, while for cancer applications, cell migration and invasion assays may be more appropriate.

How should researchers analyze MGAT4A enzymatic activity data for optimal interpretation?

Robust analysis of MGAT4A enzymatic activity data requires careful consideration of experimental variables and appropriate data processing:

  • Enzyme Kinetics Analysis:

    • Calculate Michaelis-Menten parameters (Km, Vmax) for both UDP-GlcNAc and glycan substrates

    • Plot Lineweaver-Burk or Eadie-Hofstee transformations for inhibition studies

    • Determine inhibition constants (Ki) and inhibition types for potential modulators

  • Controls and Normalization:

    • Include no-enzyme controls to account for non-enzymatic reactions

    • Use internal standards for gel-shift assays to normalize between experiments

    • Validate activity using reference compounds with known effects

  • Statistical Approaches:

    • Apply appropriate statistical tests based on data distribution (parametric vs. non-parametric)

    • Use ANOVA with post-hoc tests for multiple condition comparisons

    • Calculate Z' factor for high-throughput screening data to assess assay quality

  • Data Visualization:

    • Create reaction progress curves to ensure linearity during rate measurements

    • Plot dose-response curves using four-parameter logistic regression

    • Present data using consistent formats that highlight key comparisons

Sample data table for enzyme kinetics analysis:

[UDP-GlcNAc] (μM)Initial Velocity (pmol/min)1/[S] (μM⁻¹)1/V (min/pmol)
250.420.0402.381
500.780.0201.282
1001.350.0100.741
2002.100.0050.476
5003.250.0020.308
10003.750.0010.267

What are the most common sources of error in MGAT4A research and how can they be mitigated?

Identifying and mitigating common sources of error is crucial for generating reliable MGAT4A research data:

Error SourceImpactMitigation Strategy
Enzyme instabilityReduced activity, inconsistent resultsOptimize storage conditions, add stabilizers, prepare fresh aliquots
Substrate quality variationAltered reaction kineticsUse validated, high-purity substrates with QC testing
UDP-GlcNAc degradationDecreased apparent activityPrepare fresh solutions, store appropriately with stability monitoring
Metal ion concentrationSuboptimal catalytic efficiencyOptimize Mn²⁺ or other cofactor concentrations, control chelating agents
pH fluctuationsActivity variationsUse appropriate buffering systems, verify pH stability during reactions
Temperature inconsistencyReaction rate variationsUse calibrated equipment, maintain consistent incubation conditions
Protein quantification errorsIncorrect specific activity calculationsUse multiple quantification methods, include protein standards
Expression tag interferenceModified activity profileCompare tagged vs. untagged proteins, optimize tag position
Glycosylation heterogeneityInconsistent enzyme propertiesCharacterize glycoform distribution, standardize expression systems
Detection method limitationsInadequate sensitivity or linearityValidate detection methods across expected concentration ranges

By implementing systematic quality control procedures and standardized protocols, researchers can significantly improve data reproducibility. Additionally, transparent reporting of potential limitations and thorough method validation enhances the robustness of research findings in the MGAT4A field.

What recent discoveries have enhanced our understanding of MGAT4A regulation?

Recent research has revealed several important aspects of MGAT4A regulation:

  • Structural Insights: Studies have identified a lectin domain within MGAT4A that regulates its enzymatic activity, providing new understanding of how the enzyme's function is controlled at the molecular level .

  • Transcriptional Regulation: High-fat diet consumption has been shown to cause transcriptional downregulation of Mgat4a in mice, contributing to diabetic phenotypes . This suggests dietary factors may influence MGAT4A expression levels.

  • Post-translational Modifications: Emerging evidence indicates that MGAT4A itself may be subject to post-translational modifications, including glycosylation at three potential N-glycosylation sites, which may create feedback regulatory mechanisms .

  • Tissue-Specific Expression Control: Research has highlighted the particularly high expression of MGAT4A in gastrointestinal tissues, especially the pancreas, suggesting tissue-specific regulatory mechanisms that control MGAT4A expression patterns .

  • Metabolic Sensing: MGAT4A activity appears responsive to cellular metabolic status, potentially through the availability of UDP-GlcNAc, which serves as both substrate and indicator of nutrient flux through the hexosamine biosynthetic pathway.

These regulatory insights provide potential points of intervention for therapeutic approaches targeting MGAT4A activity or expression levels in diseases such as diabetes and cancer.

How do research findings compare between bovine and human MGAT4A models?

Comparative research between bovine and human MGAT4A models reveals important similarities and differences:

AspectHuman MGAT4ABovine MGAT4AResearch Implications
Sequence HomologyReference95% amino acid identity with human High conservation supports translational relevance
Enzymatic FunctionTransfer of β1,4-GlcNAc to N-glycansSame catalytic activityFunctional conservation across species
Tissue DistributionWidespread with high expression in pancreas, spleen, thymusSimilar pattern with some species-specific variationsConsider tissue context when extrapolating findings
Disease AssociationsType 2 diabetes, various cancersLess extensively studiedHuman disease models may have translational value
Structural ElementsN-terminal transmembrane domain, catalytic domain, C-terminal carbohydrate binding moduleConserved domain architectureStructural insights likely transferable between species
Glycan Substrate PreferenceWell-characterizedPresumed similar but requires verificationMay need species-specific substrate optimization

What are the major challenges in producing high-quality recombinant MGAT4A?

Producing high-quality recombinant MGAT4A presents several technical challenges:

  • Membrane Protein Expression: As a type II membrane protein, MGAT4A contains a transmembrane domain that can complicate expression and folding in heterologous systems . Strategies often involve expressing truncated forms lacking the transmembrane domain.

  • Glycosylation Considerations: MGAT4A itself contains potential N-glycosylation sites , creating a challenge when expressing in systems with different glycosylation machinery. Expression in mammalian cells may provide more native-like glycosylation compared to bacterial or insect cell systems.

  • Protein Folding and Solubility: The complex domain structure including catalytic and carbohydrate-binding modules can lead to folding challenges and aggregation. Optimization of expression conditions (temperature, induction parameters) and inclusion of folding chaperones may improve yield.

  • Catalytic Activity Preservation: Maintaining enzymatic function during purification requires careful consideration of buffer components, particularly metal ions like Mn²⁺ that are essential for activity.

  • Stability Issues: Glycosyltransferases often show limited stability, requiring optimization of storage conditions and potentially the addition of stabilizing agents like glycerol.

  • Purification Challenges: Achieving high purity without compromising activity often requires balancing purification stringency with activity preservation. Affinity tags (His-tag, as used in recombinant preparations ) can facilitate purification but may affect activity if improperly positioned.

  • Quality Control: Ensuring batch-to-batch consistency requires comprehensive characterization of both protein properties and enzymatic activity.

Addressing these challenges typically requires systematic optimization of expression systems, purification protocols, and formulation conditions to yield recombinant MGAT4A with consistent activity and stability.

How can researchers troubleshoot inconsistent results in MGAT4A activity assays?

When facing inconsistent results in MGAT4A activity assays, researchers should implement a systematic troubleshooting approach:

  • Enzyme Quality Assessment:

    • Verify protein concentration using multiple methods (Bradford, BCA)

    • Check purity by SDS-PAGE with Coomassie staining

    • Assess protein integrity via Western blot

    • Consider fresh enzyme preparation if activity has declined

  • Substrate Evaluation:

    • Verify UDP-GlcNAc quality using HPLC or mass spectrometry

    • Confirm glycan substrate integrity

    • Prepare fresh substrate solutions

  • Reaction Conditions Audit:

    • Verify buffer composition and pH

    • Confirm metal ion concentrations

    • Check incubation temperature stability

    • Validate timing consistency

  • Detection System Validation:

    • For fluorescent assays, verify excitation/emission settings

    • For gel-shift assays, confirm consistent gel preparation and running conditions

    • Include positive and negative controls

  • Systematic Parameter Variation:

    • Perform enzyme titration to identify optimal concentration

    • Conduct time course experiments to ensure linearity

    • Test buffer component variations to identify sensitive parameters

  • Equipment Calibration:

    • Verify pipette calibration

    • Check incubator temperature accuracy

    • Validate fluorescence reader performance with standards

  • Data Analysis Review:

    • Examine raw data for outliers

    • Verify calculation methods

    • Consider alternative data fitting approaches

Documenting all troubleshooting steps in a systematic lab notebook format allows identification of critical variables affecting assay performance. A methodical approach focusing on one variable at a time will typically identify the source of inconsistency more efficiently than changing multiple parameters simultaneously.

What emerging technologies could advance MGAT4A research?

Several emerging technologies show substantial promise for advancing MGAT4A research:

  • CRISPR-Based Approaches:

    • Precise genome editing for creating isogenic cell lines with MGAT4A modifications

    • CRISPRa/CRISPRi systems for controlled expression modulation

    • Base editing for introducing specific mutations to study structure-function relationships

  • Advanced Glycan Analysis Technologies:

    • Ion mobility-mass spectrometry for improved glycan isomer discrimination

    • Single-cell glycomics to reveal heterogeneity in glycosylation patterns

    • Imaging mass spectrometry for spatial distribution of MGAT4A-modified glycans in tissues

  • Cryo-EM and Advanced Structural Biology:

    • High-resolution structures of MGAT4A in different conformational states

    • Visualization of enzyme-substrate complexes

    • Structure-based drug design targeting specific domains

  • Organoid and Microphysiological Systems:

    • Pancreatic organoids for studying MGAT4A in a physiologically relevant context

    • Organ-on-chip platforms incorporating multiple cell types for integrated analysis

    • Patient-derived systems to study individual variation in MGAT4A function

  • Artificial Intelligence and Computational Approaches:

    • Machine learning for predicting MGAT4A substrate preferences

    • Molecular dynamics simulations of enzyme-substrate interactions

    • Systems biology models integrating glycosylation into cellular networks

  • Glycoengineering Tools:

    • Chemoenzymatic approaches for precise glycan remodeling

    • Cell-free glycosylation systems for controlled synthesis

    • Metabolic glycoengineering to introduce modified sugars in vivo

These technologies, particularly when used in complementary combinations, have the potential to significantly accelerate our understanding of MGAT4A function and its therapeutic applications.

What are the most promising research questions about MGAT4A that remain unanswered?

Several critical questions about MGAT4A remain unanswered, representing promising avenues for future research:

  • Structural Determinants of Specificity:

    • What structural features determine MGAT4A's preference for specific N-glycan substrates?

    • How does the carbohydrate binding module regulate catalytic activity at the molecular level?

    • What is the detailed mechanism of the catalytic reaction?

  • Regulatory Networks:

    • How is MGAT4A expression regulated in different tissues and disease states?

    • What signaling pathways modulate MGAT4A activity in response to metabolic changes?

    • How do environmental factors like diet influence MGAT4A expression and function?

  • Target Glycoproteins:

    • Besides GLUT2, what other key glycoproteins are modified by MGAT4A?

    • Is there selective modification of specific glycoproteins by MGAT4A?

    • How does MGAT4A-mediated glycosylation affect protein-protein interactions?

  • Disease Mechanisms:

    • What is the precise mechanism by which MGAT4A deficiency leads to enhanced GLUT2 endocytosis?

    • How does altered MGAT4A expression contribute to cancer progression?

    • Are there additional diseases where MGAT4A dysfunction plays a role?

  • Therapeutic Applications:

    • Can MGAT4A activity be selectively modulated in specific tissues?

    • What is the therapeutic window for MGAT4A modulation in diabetes?

    • How can MGAT4A-based therapies be effectively delivered to target tissues?

  • Evolution and Comparative Biology:

    • How has MGAT4A function evolved across species?

    • What explains the high conservation of sequence between species?

    • Are there species-specific adaptations in MGAT4A function related to dietary patterns?

Addressing these questions will require interdisciplinary approaches combining structural biology, glycobiology, cell biology, and physiological studies, potentially leading to breakthrough advances in both basic science understanding and therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.