Recombinant Bovine Alpha-2A adrenergic receptor (ADRA2A)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant bovine ADRA2A is produced by cloning the bovine ADRA2A gene into expression systems (e.g., E. coli, mammalian cells) to generate purified receptor proteins for research. This approach enables large-scale production and precise characterization of the receptor’s ligand-binding and signaling mechanisms .

Key steps in production include:

  • Gene Cloning: Isolation of the bovine ADRA2A gene, which shares high homology with human and rodent counterparts (~90% amino acid identity) .

  • Expression: Use of HEK293 or baculovirus systems to ensure proper post-translational modifications .

  • Purification: Affinity chromatography tags (e.g., GST, His) for isolation .

Research Applications

Recombinant bovine ADRA2A is utilized in:

  • Drug Discovery: Screening for subtype-selective agonists/antagonists (e.g., dexmedetomidine for sedation, yohimbine for hypertension) .

  • Biased Signaling Studies: Investigating G protein vs. β-arrestin pathways using mutagenesis (e.g., Y409A mutation enhances arrestin recruitment) .

  • Metabolic Research: Exploring roles in stress-induced hyperglycemia, as α2AAR activation inhibits insulin secretion .

Key Research Findings

  • Genetic Variants: Single-nucleotide polymorphisms (e.g., rs10885122) in ADRA2A correlate with stress-induced hyperglycemia in humans, suggesting conserved metabolic roles in mammals .

  • Species-Specific Pharmacology: Bovine receptors may exhibit subtle ligand affinity differences due to amino acid variations in transmembrane domains (e.g., position 5.42) .

Challenges and Future Directions

  • Structural Data Gap: No bovine-specific α2AAR structures limit mechanistic insights.

  • Functional Redundancy: Overlap with α2C receptor roles complicates subtype-specific analysis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preferred format in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our standard shipping includes blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50% and can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type in mind, please inform us and we will prioritize its development for your product.
Synonyms
ADRA2A; Alpha-2A adrenergic receptor; Alpha-2A adrenoreceptor; Alpha-2A adrenoceptor; Alpha-2AAR; Alpha-2D adrenergic receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISFEKKRGRSG QPSAEPRCEINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDATA AELPGSAERRPNGLGPERGGVGPVGAEVESLQVQLNGAPGEPAPAGAGADALDLEESSSS EHAERPPGSRRSERGPRAKGKARASQVKPGDSLPRRGPGATGLGAPTAGPAEERSGGGAK ASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAIGCPVPPTLFKFFFWFGYCN SSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. They are a component of the ATAC complex, which exhibits histone acetyltransferase activity on histones H3 and H4.
Database Links

KEGG: bta:282135

UniGene: Bt.88699

Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2A sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Retina, brain and olfactory lobe.

Q&A

What is the bovine Alpha-2A adrenergic receptor and what are its primary functions?

The bovine Alpha-2A adrenergic receptor (ADRA2A) is a G protein-coupled receptor that mediates the effects of catecholamines, particularly norepinephrine. It functions primarily by inhibiting adenylate cyclase through G protein activation, particularly the G(i)/G(o) family of G-proteins. ADRA2A acts as a presynaptic autoinhibitory receptor in noradrenergic neurons, dynamically regulating neurotransmitter release from sympathetic nerves and adrenergic neurons in the central nervous system . Additionally, ADRA2A plays important roles in vasoconstriction, insulin secretion regulation, and broader neurotransmission processes . Recent research has also suggested ADRA2A may be a component of the ATAC complex, which has histone acetyltransferase activity on histones H3 and H4, potentially linking this receptor to epigenetic regulation .

What are the most effective methods for detecting recombinant bovine ADRA2A in experimental samples?

Several complementary methods can be employed for detecting recombinant bovine ADRA2A, each with specific advantages:

  • ELISA-based detection: Specialized ELISA kits designed for bovine ADRA2A offer high sensitivity for quantifying receptor levels in serum, plasma, tissue homogenates, and cell culture supernatants . These kits typically employ antibodies specific to bovine ADRA2A epitopes.

  • Western blot analysis: Immunoblotting using antibodies such as PA1-048 can detect ADRA2A as an approximately 45 kDa protein. The most effective antibodies target conserved regions, such as the third intracellular loop which contains residues that are preserved across species .

  • Immunohistochemistry: This approach allows for localization of ADRA2A within tissues and cells, providing spatial context to expression patterns. For optimal results, antibodies recognizing conserved regions between species should be used .

For recombinant bovine ADRA2A specifically, validation of detection methods is crucial, as cross-reactivity between species can occur due to high sequence homology in certain domains. The third intracellular loop region (residues R(218) to G(235) in human ADRA2A) is completely conserved between human, mouse, rat, and porcine ADRA2A, making antibodies targeting this region potentially useful for bovine studies as well .

How does bovine ADRA2A compare structurally with human and other mammalian ADRA2A receptors?

Bovine ADRA2A shares significant structural homology with human and other mammalian ADRA2A receptors, particularly in functional domains. Key structural comparisons include:

SpeciesUniProt IDMolecular WeightKey Conserved RegionsNotable Differences
BovineQ28838~45 kDa3rd intracellular loopSpecies-specific glycosylation patterns
HumanP08913~45 kDa3rd intracellular loopCommon polymorphisms at residue 251 (Asn/Lys)
MouseQ01338~45 kDa3rd intracellular loopMinor variations in N-terminal domain
RatP22909~45 kDa3rd intracellular loopSimilar to mouse ADRA2A structure

The third intracellular loop is particularly well-conserved across species and plays a crucial role in G-protein coupling . This conservation explains why antibodies developed against one species may cross-react with ADRA2A from other species. The sequence corresponding to residues R(218) to G(235) in the third intracellular loop of human ADRA2A is completely conserved across human, mouse, rat, and porcine ADRA2A . This conservation likely extends to bovine ADRA2A as well, making this region an important target for detection and functional studies.

Despite the high degree of conservation, species-specific variations exist, particularly in regulatory regions and post-translational modifications, which may influence receptor pharmacology, trafficking, and signaling dynamics across species.

What expression systems are most appropriate for producing functional recombinant bovine ADRA2A?

Several expression systems have proven effective for producing functional recombinant ADRA2A, with selection depending on research objectives:

  • Mammalian cell lines (CHO and COS-7): These represent the gold standard for functional studies as they provide proper post-translational modifications and trafficking. Studies have successfully expressed both wild-type and polymorphic variants of ADRA2A in CHO and COS-7 cells for ligand binding and functional coupling assays .

  • Insect cell systems (Sf9, Sf21): These provide higher protein yields while maintaining most post-translational modifications. For bovine ADRA2A specifically, baculovirus-infected insect cells can produce receptors suitable for structural studies.

  • E. coli expression systems: Although challenging for full-length GPCRs, bacterial systems can express receptor fragments or domains for antibody production or structural studies.

For functional studies, mammalian expression systems are strongly recommended as they support appropriate receptor folding, trafficking, and G-protein coupling. When establishing a recombinant expression system for bovine ADRA2A, several considerations are essential:

  • Use of appropriate species-specific signal sequences

  • Incorporation of epitope tags that don't interfere with ligand binding or G-protein coupling

  • Selection of vectors with promoters suitable for stable expression levels

  • Verification of functional coupling through GTPγS binding, adenylyl cyclase inhibition, or MAP kinase activation assays

How can I design experiments to study bovine ADRA2A polymorphisms and their functional implications?

Designing experiments to investigate bovine ADRA2A polymorphisms requires a systematic approach:

  • Polymorphism identification: Begin with genomic sequencing of the bovine ADRA2A gene from diverse cattle breeds to identify single nucleotide polymorphisms (SNPs). Focus particularly on regions analogous to known functional human polymorphisms, such as the Asn251Lys variation in the third intracellular loop .

  • Recombinant expression: Create expression constructs containing identified polymorphic variants. Express these in mammalian cell lines (such as CHO or COS-7) as these systems have been validated for ADRA2A functional studies .

  • Receptor characterization protocol:

    • Verify expression levels using radioligand binding or Western blot

    • Assess basal receptor function and ligand binding properties

    • Evaluate agonist-promoted signaling using multiple functional assays

  • Functional assays for detecting polymorphism effects:

    • [35S]GTPγS binding to measure G protein activation

    • Adenylyl cyclase inhibition assays (polymorphic human ADRA2A shows differential inhibition: 60±4.4% vs 46±4.1%)

    • MAP kinase stimulation (human polymorphic variants show dramatic differences: 57±9 fold vs 15±2 fold increases)

    • Inositol phosphate accumulation assays

    • Receptor internalization and trafficking studies

  • Haplotype analysis: Determine if identified polymorphisms exist within specific haplotype blocks, as observed in human ADRA2A studies where single haplotype blocks of at least 11kb were identified .

When analyzing polymorphism effects, it is critical to compare multiple functional parameters, as some polymorphisms may affect specific signaling pathways while leaving others intact. The human Asn251Lys polymorphism, for example, enhances agonist-promoted function without affecting expression, ligand binding, or basal receptor function .

What are the best methods for validating antibody specificity when working with bovine ADRA2A?

Validating antibody specificity for bovine ADRA2A is critical for ensuring reliable experimental results. A comprehensive validation approach should include:

  • Western blot validation:

    • Use recombinant bovine ADRA2A as a positive control

    • Include samples from ADRA2A knockout models as negative controls when available

    • Perform peptide competition assays using the immunizing peptide

    • Assess cross-reactivity with related adrenergic receptor subtypes (alpha-2B and alpha-2C)

  • Immunoprecipitation followed by mass spectrometry:

    • This confirms that the immunoprecipitated protein is indeed ADRA2A

    • Particularly useful for antibodies intended for co-immunoprecipitation studies

  • Immunohistochemical validation:

    • Compare antibody staining patterns with known ADRA2A expression patterns

    • Include appropriate tissue controls (kidney membrane preparations have been used successfully)

    • Perform parallel experiments with multiple antibodies targeting different epitopes

  • Cross-species reactivity evaluation:

    • Test antibodies on samples from species with known sequence similarity

    • Antibodies targeting the conserved third intracellular loop (e.g., residues corresponding to R(218)-G(235) in human ADRA2A) may show cross-reactivity with bovine ADRA2A

  • Recombinant expression systems:

    • Test antibodies on cells transfected with bovine ADRA2A versus non-transfected controls

    • Use epitope-tagged constructs as parallel validation methods

When selecting commercial antibodies, those recognizing peptides from conserved regions (like the third intracellular loop) offer higher probability of cross-species reactivity . For example, antibody PA1-048, which targets residues in the third intracellular loop, detects ADRA2A from multiple species including human, rat, and mouse, and may be suitable for bovine studies due to sequence conservation .

How do polymorphisms in bovine ADRA2A influence receptor function compared to known human polymorphisms?

While specific bovine ADRA2A polymorphisms are less thoroughly characterized than human variants, comparative analysis provides valuable insights:

In humans, the Asn251Lys polymorphism in the third intracellular loop significantly enhances receptor function. This variant shows approximately 40% greater agonist-promoted [35S]GTPγS binding, enhanced inhibition of adenylyl cyclase (60±4.4% versus 46±4.1%), and markedly enhanced MAP kinase stimulation (57±9 versus 15±2-fold increase over basal) . The potency of epinephrine in stimulating inositol phosphate accumulation is also increased approximately 4-fold with the Lys-251 receptor .

For bovine ADRA2A research, similar functional domains should be investigated for polymorphisms, particularly:

  • Third intracellular loop variations: Given the importance of this region for G-protein coupling, polymorphisms here likely impact signaling efficiency. Researchers should systematically sequence this region across diverse cattle breeds to identify variations.

  • Species-specific functional consequences: Unlike human polymorphisms where the Lys-251 variant represents a gain of agonist-promoted function, bovine polymorphisms may display different functional signatures. This necessitates comprehensive pharmacological profiling including:

    • Ligand binding studies with diverse agonists (catecholamines, azepines, and imidazolines)

    • G-protein coupling efficiency assessments

    • Downstream signaling pathway activation measurements

  • Tissue-specific effects: Polymorphisms may influence receptor function differently across tissues due to varying G-protein subtype availability and expression of regulatory proteins.

When designing studies to characterize bovine ADRA2A polymorphisms, it's important to note that different agonist classes (catecholamines, azepines, imidazolines) may display differential sensitivity to specific polymorphisms, as observed with human variants . Additionally, population distribution of polymorphisms should be assessed across different cattle breeds, similar to human studies showing 10-fold greater frequency of Lys-251 in African-Americans compared to Caucasians .

What are the current challenges in developing functional assays for recombinant bovine ADRA2A and how can they be addressed?

Developing robust functional assays for recombinant bovine ADRA2A faces several challenges that require methodological refinements:

  • Receptor expression level variability:

    • Challenge: Inconsistent expression levels between experiments affect functional readouts

    • Solution: Implement tetracycline-inducible expression systems to precisely control receptor density. Quantitative radioligand binding assays should be performed in parallel with functional studies to normalize responses to receptor expression levels.

  • G-protein coupling specificity:

    • Challenge: ADRA2A can couple to multiple G-protein subtypes with varying efficiency

    • Solution: Use BRET/FRET-based assays to directly measure receptor-G protein interactions. These systems allow real-time monitoring of specific G-protein coupling events in living cells, providing more direct assessment of receptor functionality.

  • Signaling pathway crosstalk:

    • Challenge: Secondary signaling events complicating interpretation of primary coupling events

    • Solution: Employ rapid kinetic measurements to distinguish primary from secondary signaling events. Additionally, use specific inhibitors to isolate individual signaling pathways.

  • Species-specific pharmacological profiles:

    • Challenge: Translating human ADRA2A pharmacology to bovine systems may be problematic

    • Solution: Develop comprehensive bovine-specific pharmacological profiles using diverse ligand panels. Both radioligand binding and functional assays should be performed with species-specific reference compounds.

  • Effective assay validation strategies:

    • Positive controls: Use forskolin for adenylyl cyclase assays and phorbol esters for MAPK studies

    • Internal standards: Include reference compounds in every assay plate

    • Z-factor determination: Calculate for each assay to ensure statistical robustness

    • Replicate design: Minimum triplicate determinations across multiple independent experiments

For adenylyl cyclase inhibition assays specifically, researchers should consider implementing BRET-based cAMP biosensors, which provide real-time, non-destructive measurements with improved sensitivity over traditional methods. When studying MAP kinase activation, phospho-specific antibodies in cell-based ELISA formats offer higher throughput than traditional Western blotting approaches used in early ADRA2A polymorphism studies .

How can haplotype analysis be applied to study bovine ADRA2A genetic variations in different cattle breeds?

Haplotype analysis provides powerful insights into genetic architecture and functional variation of bovine ADRA2A across cattle breeds. Based on approaches used in human ADRA2A research, a comprehensive bovine haplotype analysis should include:

  • Marker selection strategy:

    • Sequence the entire bovine ADRA2A gene plus 5kb upstream/downstream regions

    • Select single nucleotide polymorphisms (SNPs) evenly spaced across this region

    • Include all known functional polymorphisms

    • For optimal coverage, approximately 3-6 markers per haplotype block should be sufficient based on human studies

  • Population sampling approach:

    • Include diverse cattle breeds representing different geographical origins and selection histories

    • Minimum sample size of 50-100 animals per breed for reliable haplotype frequency estimation

    • Include both commercial and indigenous breeds to capture maximum genetic diversity

  • Analytical methodology:

    • Employ haploview or similar software for haplotype block identification

    • Apply tagging SNP algorithms to identify minimal marker sets capturing maximum haplotype diversity

    • Utilize phase determination algorithms for accurate haplotype reconstruction

  • Functional correlation analysis:

    • Test associations between identified haplotypes and phenotypic traits

    • Screen for correlations with production traits, disease susceptibility, or drug response variability

    • Develop in vitro expression systems to test functional consequences of different haplotypes

When implementing this approach, researchers should note that haplotype information can capture functional variation even when the causal variant itself is not directly genotyped . This property makes haplotype analysis particularly valuable for initial screening across multiple breeds before investing in detailed functional characterization of specific variants.

What experimental approaches are most effective for studying ADRA2A-mediated signaling in bovine tissue samples?

Studying ADRA2A-mediated signaling in bovine tissues requires specialized approaches to accommodate tissue complexity and preserve receptor function:

  • Ex vivo tissue preparations:

    • Fresh tissue slices maintain native receptor environment and signaling networks

    • Synaptosomes from bovine brain tissue allow study of presynaptic ADRA2A function

    • Isolated blood vessels enable investigation of vasoconstrictive responses

  • Primary cell isolation techniques:

    • Isolation of bovine adrenal chromaffin cells for studying catecholamine release regulation

    • Primary neuronal cultures from bovine brain regions expressing ADRA2A

    • Bovine vascular smooth muscle cells for contractility studies

  • Signaling pathway analysis methods:

    • Real-time cAMP measurements using FRET-based sensors in primary cells

    • Calcium imaging for monitoring ADRA2A-mediated calcium flux

    • Phospho-specific Western blotting for MAP kinase cascade activation

    • Electrophysiological recordings to study channel modulation

  • Receptor regulation studies:

    • Radioligand binding with selective ADRA2A ligands in membrane preparations

    • Receptor internalization assays using fluorescently-labeled ligands

    • Immunohistochemistry to track receptor expression and localization

For optimal physiological relevance, measurements should be performed in freshly isolated tissues when possible. When working with bovine tissue samples, several experimental considerations are crucial:

  • Rapid tissue processing (within 30 minutes of collection) minimizes receptor desensitization

  • Use of appropriate physiological buffers with species-optimized composition

  • Inclusion of phosphatase and protease inhibitors for signaling pathway analysis

  • Careful validation of antibody specificity in bovine tissues before use in signaling studies

When comparing results between recombinant systems and native tissues, researchers should be aware that signaling efficiency and coupling preferences may differ significantly due to variations in G-protein expression levels and the presence of regulatory proteins in tissue environments.

How does the bovine ADRA2A receptor interact with different ligands compared to human ADRA2A, and what are the implications for cross-species pharmacology?

Understanding cross-species pharmacological differences is essential for translating ADRA2A research between bovine and human systems:

  • Comparative binding profiles:

    • While core binding pocket architecture is likely conserved between species, subtle amino acid differences can impact ligand affinity and selectivity

    • Comprehensive radioligand displacement studies should be conducted with diverse ligand classes (catecholamines, imidazolines, azepines)

    • Binding studies with selective antagonists can reveal species-specific binding pocket characteristics

  • Functional response differences:

    • Comparing potency and efficacy of standard agonists across species using identical assay platforms

    • Evaluating biased signaling properties of ligands between species (G-protein vs β-arrestin pathways)

    • Determining species differences in receptor desensitization and internalization kinetics

  • Structural basis of species differences:

    • Homology modeling based on crystal structures of related GPCRs

    • Molecular dynamics simulations to identify species-specific conformational preferences

    • Site-directed mutagenesis to confirm key residues responsible for pharmacological differences

  • Pharmacological implications:

    • Development of species-selective compounds for research applications

    • Understanding the limitations of using human ADRA2A ligands in bovine systems

    • Optimizing drug discovery approaches for veterinary applications

Studies on human ADRA2A polymorphisms provide insights into potential areas of species variation. The Asn251Lys polymorphism in humans affects responses to different ligand classes to varying degrees, with catecholamines, azepines, and imidazolines showing differential sensitivity to this variation . Similar binding pocket or G-protein coupling interface variations likely exist between bovine and human ADRA2A.

For experimental design, a minimum panel for cross-species comparison should include:

  • Endogenous agonists (epinephrine, norepinephrine)

  • Synthetic agonists (clonidine, dexmedetomidine)

  • Subtype-selective antagonists (yohimbine, BRL-44408)

  • Novel ligands being developed for therapeutic applications

What are the challenges in resolving contradictory research findings regarding ADRA2A function, and how can these be addressed in bovine research?

Contradictory findings in ADRA2A research stem from multiple factors that require methodological standardization and careful experimental design:

  • Receptor expression level variations:

    • Contradiction source: Studies using different expression levels report divergent functional outcomes

    • Resolution approach: Implement radioligand binding in parallel with functional assays to normalize responses to receptor density. Report results as response per receptor rather than per cell.

  • G-protein subtype availability:

    • Contradiction source: Cell systems with different G-protein expression profiles yield inconsistent results

    • Resolution approach: Characterize G-protein expression in experimental systems; consider co-expression of specific G-protein subtypes to standardize coupling efficiency.

  • Methodological differences in functional assays:

    • Contradiction source: Different assay platforms measure distinct aspects of receptor function

    • Resolution approach: Employ multiple complementary assays (GTPγS binding, adenylyl cyclase inhibition, MAP kinase activation) to obtain comprehensive functional profiles.

  • Genetic background variations:

    • Contradiction source: Unrecognized polymorphisms or haplotype differences between study populations

    • Resolution approach: Complete genotyping/sequencing of ADRA2A in study samples; haplotype-based analysis as demonstrated in human studies .

  • Specific challenges in bovine research:

    • Limited standardization of bovine cell lines and primary cultures

    • Breed-specific variations that may go unrecognized

    • Fewer validated reagents compared to human research

One notable contradiction appears in the literature regarding ADRA2A genetic associations with behavioral traits. For example, while some studies link ADRA2A polymorphisms to ADHD symptoms in Caucasian populations, similar associations were not replicated in Han Chinese populations . This highlights the importance of population-specific genetic architecture in interpreting ADRA2A genetic associations.

For bovine research specifically, establishing:

  • Reference sequences for major commercial breeds

  • Standardized cell systems derived from defined genetic backgrounds

  • Breed-specific primary cell isolation protocols

  • Comprehensive haplotype maps similar to those developed for human ADRA2A

Would significantly reduce contradictions and improve research reproducibility across laboratories.

How can CRISPR/Cas9 genome editing be optimized for studying bovine ADRA2A function and polymorphisms?

CRISPR/Cas9 technology offers unprecedented opportunities for precise manipulation of bovine ADRA2A, though with unique optimization requirements:

  • Guide RNA design considerations for bovine ADRA2A:

    • Design guide RNAs targeting conserved regions to increase editing efficiency

    • Use bovine-specific genome databases to ensure accurate target selection

    • Employ multiple bioinformatic tools to minimize off-target effects

    • Include positive control guides targeting established bovine genomic sites

  • Delivery methods for bovine cell systems:

    • For primary bovine cells: Nucleofection often provides superior efficiency

    • For established bovine cell lines: Lipid-based transfection or lentiviral delivery

    • For bovine embryo editing: Microinjection of ribonucleoprotein complexes

  • Editing strategies for functional studies:

    • Knockout applications: Generate complete ADRA2A knockout cell lines as negative controls for antibody validation and signaling studies

    • Knock-in applications: Introduce specific polymorphisms identified in different cattle breeds

    • Reporter systems: Create endogenous ADRA2A-fluorescent protein fusions for trafficking studies

    • Epitope tagging: Insert small epitopes for improved detection without affecting function

  • Validation approaches:

    • Sequence verification with both Sanger and next-generation sequencing

    • Functional validation using pharmacological profiling

    • Off-target analysis through whole-genome sequencing of edited lines

    • Transcriptomic assessment to identify compensatory mechanisms

  • Specialized applications:

    • Allele-specific editing: Target only specific ADRA2A alleles in heterozygous systems

    • Inducible systems: Combine CRISPR with inducible promoters for temporal control

    • Base editing: Precise nucleotide substitutions without double-strand breaks

    • Prime editing: Precise editing with minimal off-target effects

When implementing CRISPR approaches for bovine ADRA2A, researchers should specifically consider targeting the third intracellular loop region, which contains known functional polymorphisms in human ADRA2A (such as the Asn251Lys variant) . Creating analogous modifications in bovine ADRA2A would allow direct cross-species functional comparisons and assessment of evolutionary conservation of receptor regulatory mechanisms.

What role does ADRA2A play in bovine stress responses and how can this inform veterinary applications?

ADRA2A serves as a critical regulator of stress responses in mammals, with important implications for bovine health and productivity:

  • Physiological mechanisms of ADRA2A in bovine stress:

    • Presynaptic ADRA2A receptors regulate norepinephrine release during stress

    • Central ADRA2A activation modulates hypothalamic-pituitary-adrenal axis function

    • Peripheral ADRA2A mediates cardiovascular responses to stress

  • Experimental approaches for studying bovine stress responses:

    • In vivo monitoring of plasma catecholamine levels in response to stressors

    • Ex vivo studies of bovine adrenal chromaffin cells for catecholamine release

    • Physiological monitoring (heart rate variability, cortisol) after ADRA2A-targeted interventions

    • Behavioral assessments following administration of ADRA2A agonists/antagonists

  • Genetic associations with stress susceptibility:

    • Screening for ADRA2A polymorphisms associated with stress resilience

    • Haplotype analysis across breeds with different stress susceptibility profiles

    • Expression quantitative trait loci (eQTL) studies to identify regulatory variants

  • Translational applications:

    • Development of ADRA2A-targeted interventions for managing transport stress

    • Breeding strategies incorporating ADRA2A genetic markers for stress resilience

    • Optimized protocols for perioperative use of alpha-2 agonists in cattle

Research on human ADRA2A polymorphisms provides a template for similar investigations in cattle. The human Asn251Lys polymorphism, with its enhanced signaling properties , might have parallels in bovine populations that influence individual stress responses. Similar variations in bovine ADRA2A could explain breed differences in temperament and stress resilience.

For veterinary applications, understanding the pharmacological and genetic factors influencing ADRA2A function could lead to more personalized approaches to anesthesia and sedation in cattle. Alpha-2 agonists like xylazine and detomidine are widely used in bovine medicine, and their efficacy might be influenced by genetic variations similar to those observed with human ADRA2A polymorphisms .

How do epigenetic modifications influence bovine ADRA2A expression in different physiological states?

Epigenetic regulation of ADRA2A represents an emerging area of research with implications for understanding dynamic receptor expression:

  • Key epigenetic mechanisms affecting ADRA2A:

    • DNA methylation of the ADRA2A promoter region

    • Histone modifications influencing chromatin accessibility

    • microRNA-mediated post-transcriptional regulation

    • Long non-coding RNAs modulating ADRA2A transcription

  • Physiological states affecting epigenetic regulation:

    • Development and aging processes

    • Stress exposure and adaptation

    • Metabolic states (feeding, fasting, lactation)

    • Inflammatory conditions

  • Experimental approaches for epigenetic studies:

    • Bisulfite sequencing to map DNA methylation patterns

    • ChIP-seq for histone modification profiling

    • ATAC-seq to assess chromatin accessibility

    • RNA-seq for transcriptional profiling across conditions

  • Tissue-specific considerations:

    • Comparison of epigenetic profiles across neural, cardiovascular, and adipose tissues

    • Correlation of tissue-specific epigenetic patterns with ADRA2A expression levels

    • Developmental trajectories of epigenetic modifications

The association of ADRA2A with the ATAC complex, which has histone acetyltransferase activity on histones H3 and H4 , suggests intriguing possibilities for auto-regulation. This relationship might represent a feedback mechanism where ADRA2A signaling influences its own expression through chromatin modifications.

For bovine-specific research, several approaches would be particularly valuable:

  • Comparative methylation analysis of the ADRA2A promoter across production states (growth, lactation, etc.)

  • Investigation of stress-induced epigenetic modifications and their persistence

  • Transgenerational studies examining maternal stress effects on offspring ADRA2A regulation

  • Nutritional intervention studies to determine if dietary factors can modulate ADRA2A epigenetic regulation

These approaches could provide insights into environmentally responsive regulation of bovine ADRA2A and identify potential intervention points for optimizing cattle health and productivity.

What are the most promising future directions for bovine ADRA2A research in an academic context?

The landscape of bovine ADRA2A research offers several promising avenues for academic investigation:

  • Comprehensive genetic characterization: Developing complete haplotype maps for ADRA2A across diverse cattle breeds, similar to human studies showing single haplotype blocks of 11kb . This would provide the foundation for understanding natural genetic variation and its functional consequences.

  • Structure-function relationships: Elucidating the structural basis of species-specific pharmacological responses through homology modeling, molecular dynamics simulations, and site-directed mutagenesis. This could reveal evolutionary adaptations in bovine ADRA2A function.

  • Signaling pathway integration: Mapping the complete signaling network downstream of bovine ADRA2A using phosphoproteomics and systems biology approaches. This would illuminate how ADRA2A signaling integrates with other cellular pathways in bovine tissues.

  • Developmental regulation: Investigating the ontogeny of ADRA2A expression and function from fetal development through aging. This developmental perspective could reveal critical windows for intervention in stress-related conditions.

  • Precision livestock applications: Developing genetic markers based on ADRA2A polymorphisms that predict stress resilience, drug responses, or production traits. This would translate basic receptor biology into practical agricultural applications.

Academic research on bovine ADRA2A would particularly benefit from interdisciplinary approaches combining molecular pharmacology, genetics, physiology, and computational biology. The polymorphic nature of ADRA2A, with variants showing enhanced signaling properties , provides a fascinating model for studying how genetic variation influences complex physiological traits in cattle populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.