Recombinant Bovine Alpha-2B adrenergic receptor (ADRA2B)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

The ADRA2B gene encodes a 392-amino acid protein in bovine species (UniProt ID: O77700) . The receptor contains seven transmembrane domains, a hallmark of GPCRs, and associates with guanine nucleotide exchange proteins like eIF-2B . Key structural features include:

  • N-terminal His tag: Facilitates purification via metal affinity chromatography .

  • Third intracellular loop: Contains a polyglutamyl domain that varies in length across species, influencing receptor desensitization and signaling .

Key Functional Domains

RegionFunctionSource
Transmembrane domainsLigand binding and G-protein coupling
Third intracellular loopModulates desensitization and signal transduction
C-terminal domainPhosphorylation sites for receptor regulation

Functional Studies

ADRA2B is used to investigate receptor-ligand interactions, desensitization, and signaling pathways. For example:

  • Antisense therapy: Inhibition of ADRA2B in rat models reduces salt-induced hypertension by ~35 mmHg .

  • Genetic variants: Deletion variants (e.g., del 301–303) alter receptor desensitization and basal metabolic rates in obesity .

Physiological Roles

ADRA2B regulates:

  • Blood pressure: Mediates vasoconstriction in response to salt loading .

  • Emotional memory: Variants linked to heightened amygdala responses to negative stimuli .

Therapeutic Implications

  • Hypertension: Targeting ADRA2B may reverse salt-dependent hypertension .

  • Psychiatric disorders: Modulation of ADRA2B could influence PTSD or obsessive-compulsive disorder .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADRA2B; Alpha-2B adrenergic receptor; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2BAR; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFWRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKFII LIVWLIAAVISLPPLIYKGDQGPQPLARPQCKLNQEAWYILASSIGSFFAPCLIMILVYL RIYLIAKRSHCRGPRAKGGPGERESKQPHPVPGEVSDSAKLPTLASQLATPGEANGCSQP RPGEKGDGETPEAPGTPALPPSWPAIPKSGQGQKEGVCGSSPEEEAEEEEEEGCEPQALP ASPASACSPPLQQPQGSRVLATLRGQVLLGRGTGTAGAQWWRRRTQLSREKRFTFVLAVV IGVFVLCWFPFFFSYSLGAICPQHCKVPHGLF
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2B sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Alpha-2B Adrenergic Receptor (ADRA2B) and what are its primary functions?

Alpha-2B adrenergic receptor (ADRA2B) is a G-protein coupled receptor that belongs to the adrenergic receptor family. It is encoded by the ADRA2B gene and is one of three highly homologous α2-adrenergic receptor subtypes (α2A, α2B, and α2C). ADRA2B plays a critical role in regulating neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system. At the molecular level, ADRA2B associates with eIF-2B, a guanine nucleotide exchange protein that functions in the regulation of translation.

The bovine ADRA2B protein consists of 392 amino acids, contains seven transmembrane domains, and shares significant homology with human ADRA2B, which is 450 amino acids in length. This receptor is essential for normal sympathetic nervous system function and has been implicated in several physiological processes including cardiovascular regulation, pain modulation, and emotional memory formation.

How does bovine ADRA2B differ from human ADRA2B in structure and function?

The bovine Alpha-2B adrenergic receptor differs from its human counterpart primarily in protein length and specific amino acid sequences. The human ADRA2B protein consists of 450 amino acids, while the bovine version is shorter at 392 amino acids. Despite these differences, both proteins maintain the characteristic seven transmembrane domain structure typical of G-protein coupled receptors.

Functionally, both human and bovine ADRA2B serve similar roles in adrenergic signaling, but species-specific variations in binding affinities for ligands and downstream signaling pathways have been reported. These differences should be carefully considered when using bovine ADRA2B as a model for human receptor studies. The conservation of key functional domains between species makes bovine ADRA2B a valuable research tool, particularly for initial screening of potential ligands and for structural studies where the bovine protein may offer advantages in expression and stability.

What expression systems are typically used for recombinant bovine ADRA2B production?

Recombinant bovine ADRA2B can be produced using several expression systems, with E. coli being one of the most commonly employed for basic research applications. When expressed in E. coli, the full-length bovine ADRA2B protein (amino acids 1-392) is typically fused to affinity tags such as His-tag to facilitate purification. The resulting protein is often available as a lyophilized powder that requires reconstitution before use.

For studies requiring post-translational modifications or native membrane integration, mammalian expression systems (HEK293, CHO cells) or insect cell systems (Sf9, High Five) are preferred alternatives. These eukaryotic systems can provide properly folded and functionally active receptors that more closely resemble the native bovine ADRA2B. Yeast expression systems (Pichia pastoris, Saccharomyces cerevisiae) represent an intermediate option, offering some post-translational modifications with higher yield than mammalian systems.

The choice of expression system should be guided by the specific research requirements, balancing considerations of protein yield, functional activity, and structural authenticity.

What are the recommended storage and handling conditions for recombinant bovine ADRA2B?

Recombinant bovine ADRA2B protein, particularly when supplied as a lyophilized powder, requires careful handling to maintain its structural integrity and functional activity. The lyophilized protein should be stored at -20°C to -80°C until ready for use. When reconstituting the protein, it is advisable to use a buffer system that mimics physiological conditions (typically pH 7.2-7.4) and includes stabilizing agents such as glycerol or specific detergents appropriate for membrane proteins.

After reconstitution, the protein solution should be stored at 4°C for immediate use or aliquoted and frozen at -80°C to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity. When working with the reconstituted protein, maintain sterile conditions and consider adding protease inhibitors to prevent degradation during experimental procedures.

For long-term studies, it may be beneficial to assess protein stability periodically using techniques such as SDS-PAGE or activity assays to ensure the receptor maintains its structural and functional properties throughout the research timeline.

How can researchers effectively design functional studies to investigate bovine ADRA2B signaling pathways?

Designing effective functional studies for bovine ADRA2B signaling pathways requires a multifaceted approach. Begin by establishing a reliable receptor expression system, preferably in a cell line with minimal endogenous adrenergic signaling to reduce background interference. For signaling pathway investigations, researchers should consider implementing the following methodological approaches:

  • Radioligand binding assays: Use selective α2-adrenergic ligands (e.g., [³H]rauwolscine or [³H]UK-14,304) to characterize receptor binding properties, including Kd, Bmax, and binding kinetics. These assays can determine whether the recombinant bovine ADRA2B maintains proper ligand recognition.

  • cAMP accumulation assays: Since ADRA2B couples to Gi/o proteins, measure the inhibition of forskolin-stimulated cAMP production using ELISA or FRET-based biosensors to quantify receptor activation.

  • GTPγS binding assays: Quantify G-protein activation directly by measuring the exchange of GDP for GTP using [³⁵S]GTPγS binding protocols.

  • Ca²⁺ flux assays: Monitor intracellular calcium mobilization following receptor activation using fluorescent calcium indicators like Fura-2 or Fluo-4.

  • MAPK pathway activation: Assess ERK1/2 phosphorylation levels via Western blotting or ELISA to characterize downstream signaling events.

When comparing bovine ADRA2B signaling to human ADRA2B, researchers should systematically evaluate potential species-specific differences in ligand potency, efficacy, and signaling bias. Appropriate positive and negative controls, including selective antagonists (e.g., yohimbine) and cell lines expressing human ADRA2B, should be incorporated into experimental designs.

What are the challenges in structural studies of recombinant bovine ADRA2B and how can they be addressed?

Structural studies of recombinant bovine ADRA2B face several significant challenges inherent to membrane proteins. These challenges and potential solutions include:

  • Protein expression and purification: The hydrophobic nature of ADRA2B's seven transmembrane domains makes high-yield expression and purification difficult. Using fusion partners (e.g., MBP, SUMO) can improve solubility, while optimized detergents (DDM, LMNG) can maintain stability during purification. Implementing insect cell or mammalian expression systems may improve correct folding and yield compared to bacterial systems.

  • Protein stability: ADRA2B tends to denature easily outside its native membrane environment. Researchers can address this by screening different lipid compositions for reconstitution, using nanodiscs or lipidic cubic phase systems, or incorporating thermostabilizing mutations identified through alanine scanning or directed evolution approaches.

  • Conformational heterogeneity: As a dynamic GPCR, ADRA2B exists in multiple conformational states, complicating structural studies. Consider using conformation-stabilizing ligands or antibody fragments (e.g., nanobodies) that lock the receptor in specific states, or employ DEER spectroscopy to characterize conformational ensembles.

  • Crystallization challenges: For X-ray crystallography, the large flexible intracellular loops and C-terminus of ADRA2B can hinder crystal formation. Consider creating chimeric constructs where these regions are replaced with stable protein domains (e.g., T4 lysozyme), or use alternative methods like cryo-EM.

  • Functional validation: Ensuring that structural constructs retain native function is crucial. Implement ligand binding assays and limited signaling tests even for heavily modified constructs to verify that core receptor functions remain intact.

A systematic approach combining these strategies, along with careful optimization of each step, is most likely to yield successful structural characterization of bovine ADRA2B.

How should researchers design experiments to compare wild-type and variant forms of bovine ADRA2B?

When designing experiments to compare wild-type and variant forms of bovine ADRA2B, researchers should implement a comprehensive strategy that accounts for multiple aspects of receptor function and expression. The following methodological approach is recommended:

  • Expression system standardization: Use identical expression vectors, promoters, and cell lines for all constructs to minimize system-related variations. Ideally, create stable cell lines expressing equivalent levels of each receptor variant, confirmed by quantitative Western blotting or flow cytometry with anti-tag antibodies.

  • Receptor trafficking and localization: Employ fluorescence microscopy with tagged constructs or immunostaining to assess differences in cellular localization and membrane integration between wild-type and variant receptors. Complement this with subcellular fractionation and surface biotinylation assays for quantitative comparison.

  • Ligand binding profiles: Perform saturation and competition binding assays using a panel of α2-adrenergic ligands to detect potential alterations in binding pocket structure. Analysis should include determination of Kd, Ki, and Bmax values for each variant.

  • Signaling cascade comparison: Systematically evaluate multiple signaling pathways including:

    • cAMP inhibition

    • ERK1/2 phosphorylation

    • β-arrestin recruitment

    • Receptor internalization kinetics

    • G-protein coupling efficiency (measured by BRET or FRET)

  • Allosteric modulation sensitivity: Test whether variants display differential responses to allosteric modulators, which can reveal subtle conformational differences not apparent in orthosteric ligand binding studies.

For variants analogous to the human ADRA2B deletion polymorphism, particular attention should be paid to potential differences in desensitization and internalization rates, as these mechanisms appear significantly altered in the human receptor variant.

ParameterRecommended TechniqueKey Controls
Expression levelWestern blot, ELISALoading controls, standard curve
Surface localizationSurface biotinylation, flow cytometryTotal protein measurement
Ligand bindingRadioligand binding, TR-FRETNon-specific binding determination
G-protein coupling[³⁵S]GTPγS binding, BRET/FRETConstitutive activity control
Downstream signalingcAMP assay, Ca²⁺ flux, ERK phosphorylationPathway-specific positive controls

What are the critical controls needed when studying the interaction between recombinant bovine ADRA2B and candidate ligands?

When studying interactions between recombinant bovine ADRA2B and candidate ligands, implementing robust controls is essential for generating reliable and interpretable data. The following controls should be incorporated into experimental designs:

  • Negative controls:

    • Mock-transfected cells expressing only the vector backbone

    • Cells expressing an unrelated GPCR with similar expression levels

    • Non-specific binding determination using high concentrations (100-1000× Ki) of selective antagonists

    • Denatured receptor preparations to control for non-specific interactions

  • Positive controls:

    • Well-characterized reference ligands with known pharmacology (e.g., UK-14,304 as agonist, yohimbine as antagonist)

    • Concentration-response curves for standard ligands in each experiment to verify system responsiveness

    • Human ADRA2B receptor for cross-species comparison when relevant

  • Specificity controls:

    • Testing candidate ligands against all three α2-adrenergic receptor subtypes (α2A, α2B, α2C)

    • Competition assays against known selective ligands

    • Binding/function in the presence of subtype-selective antagonists

  • System validation:

    • Verification of receptor expression by Western blot or flow cytometry in each experiment

    • Membrane preparation quality assessment through protein content and reference ligand binding

    • Signal-to-background ratio determination for functional assays

  • Pharmacological validation:

    • Schild plot analysis for suspected antagonists

    • Evaluation of potential allosteric effects using two-site binding models

    • Assessment of signal bias through multiple pathway engagement measurements

For novel ligands demonstrating activity, orthogonal assay techniques should be employed to confirm findings. For example, if initial screening used a fluorescence-based method, validation with a radioligand binding or label-free technique provides stronger evidence for genuine interaction.

How should researchers analyze and interpret functional data from ADRA2B studies that exhibit inconsistent results across different assay systems?

When faced with inconsistent results across different assay systems in ADRA2B studies, researchers should implement a systematic troubleshooting and analytical approach to reconcile the discrepancies. The recommended methodological framework includes:

  • Assay-specific validation:

    • Determine assay sensitivity, dynamic range, and signal-to-noise ratios for each system

    • Verify that positive controls perform as expected across all platforms

    • Ensure that the concentration ranges tested cover the full dose-response relationship

    • Analyze whether time-dependent effects (e.g., receptor desensitization) might explain differences between acute and prolonged measurements

  • Receptor expression and functionality verification:

    • Quantify receptor expression levels across different experimental systems

    • Confirm membrane localization using subcellular fractionation or imaging

    • Assess baseline activity and maximum response capacity in each system

    • Determine if differences in receptor reserve could explain varying potency or efficacy measurements

  • Integrated data analysis approaches:

    • Apply operational models of receptor function to extract system-independent parameters

    • Use bias plots (ΔΔlog(τ/KA)) to visualize and quantify pathway-specific effects

    • Implement global fitting of data from multiple assays simultaneously

    • Consider Bayesian statistical approaches to incorporate uncertainty from different assay systems

  • Reconciliation strategies for discrepant results:

    • Evaluate whether apparent discrepancies reflect true biological phenomena (e.g., ligand bias, distinct conformational states)

    • Consider the temporal resolution of different assays and whether they capture different phases of receptor activation

    • Assess whether downstream amplification differs between assay systems

    • Determine if the physical environment (membrane composition, temperature, ionic conditions) varies significantly between systems

When presenting results, clearly document all assay conditions and analytical methods. Rather than selecting data from a single "preferred" system, researchers should present the integrated analysis across platforms, explicitly addressing inconsistencies and their potential biological or methodological origins.

What statistical approaches are most appropriate for analyzing complex datasets from studies on genetic variants of bovine ADRA2B?

Complex datasets from genetic variant studies of bovine ADRA2B require sophisticated statistical approaches to properly account for multiple variables, potential interactions, and varying effect sizes. The following statistical methodology is recommended:

  • Preliminary data assessment:

    • Conduct normality testing and evaluate the need for data transformation

    • Identify and address outliers through robust statistical methods rather than simple exclusion

    • Perform power analysis to ensure adequate sample sizes for detecting variant-specific effects

    • Assess measurement error and incorporate this into statistical models

  • Comparative analysis between variants:

    • For simple comparisons, use paired t-tests or repeated measures ANOVA with appropriate post-hoc corrections for multiple comparisons

    • Implement mixed-effects models to account for both fixed effects (genotype, treatment) and random effects (experimental batch, cell line variation)

    • Consider non-parametric alternatives (Wilcoxon signed-rank test, Friedman test) when normality assumptions are violated

    • Apply multivariate analysis methods (MANOVA, principal component analysis) when analyzing multiple related parameters simultaneously

  • Dose-response and kinetic data analysis:

    • Fit concentration-response data with appropriate models (four-parameter logistic, operational model) using non-linear regression

    • Compare curve parameters (EC50, Emax, Hill coefficient, τ/KA) across variants using extra sum-of-squares F test or Akaike Information Criterion

    • For kinetic data, apply compartmental models or more complex differential equation systems

    • Utilize bootstrapping or Markov Chain Monte Carlo methods to generate confidence intervals for model parameters

  • Advanced statistical approaches for complex datasets:

    • Implement Bayesian hierarchical models to integrate data across multiple experiments

    • Use machine learning approaches for pattern recognition in complex multidimensional data

    • Apply structural equation modeling to test hypothesized causal relationships between variables

    • Consider meta-analytical approaches when combining data from multiple independent studies

When reporting results, provide complete statistical information including test selection justification, exact p-values, confidence intervals, and effect sizes. Data visualization should emphasize biological significance beyond statistical significance, particularly for complex relationships between variables.

How can findings from bovine ADRA2B research inform studies on human ADRA2B polymorphisms and their clinical implications?

Research on bovine ADRA2B can provide valuable translational insights for human studies, particularly regarding the well-documented deletion polymorphism in human ADRA2B that has significant clinical implications. The methodological approach to translating bovine findings includes:

  • Comparative structure-function analysis:

    • Conduct detailed sequence alignments between bovine and human ADRA2B, focusing on regions with known polymorphisms

    • Create bovine models of human variants through site-directed mutagenesis

    • Compare ligand binding profiles, signaling patterns, and regulatory mechanisms between species to identify conserved and divergent features

    • Use homology modeling informed by bovine data to predict structural consequences of human polymorphisms

  • Translational signaling pathway investigation:

    • Identify conserved signaling nodes and regulatory mechanisms between bovine and human systems

    • Compare desensitization and internalization kinetics, particularly relevant for the human deletion variant associated with decreased receptor desensitization

    • Investigate whether findings on bovine ADRA2B-mediated regulation of translation through eIF-2B interaction extend to human variants

    • Examine if species-specific differences in signaling bias exist that might affect translational predictions

  • Physiological correlates and clinical implications:

    • Utilize bovine findings to design more focused human studies examining:

      • Emotional memory processing (the human deletion variant is associated with enhanced emotional memory)

      • Stress responsivity and trauma susceptibility

      • Metabolic regulation (the human deletion variant is associated with reduced basal metabolic rate in obese subjects)

      • Cardiovascular regulation and response to adrenergic drugs

  • Pharmacological targeting strategies:

    • Apply insights from bovine ADRA2B ligand interactions to develop subtype-selective compounds for human receptors

    • Investigate whether variant-specific pharmacological approaches might be feasible based on structural or functional differences

    • Explore allosteric modulation as a potential strategy to normalize function in polymorphic receptors

By systematically translating findings between species while acknowledging limitations, researchers can accelerate the development of personalized approaches to conditions influenced by ADRA2B polymorphisms, including emotional memory disorders, cardiovascular disease, and metabolic conditions.

What emerging technologies and methodologies show promise for advancing bovine ADRA2B research in the next decade?

The landscape of bovine ADRA2B research is poised for significant advancement through several emerging technologies and methodologies that will likely transform our understanding of this receptor system over the next decade:

  • Cryo-electron microscopy (Cryo-EM) advances:

    • Continued improvements in resolution now allow for visualization of GPCRs without crystallization

    • Application of single-particle analysis to capture multiple conformational states of bovine ADRA2B

    • Time-resolved Cryo-EM to visualize the dynamic process of receptor activation and signaling complex formation

    • Development of Cryo-electron tomography for studying ADRA2B in its native membrane environment

  • Structural biology integration:

    • Combining X-ray crystallography, Cryo-EM, and NMR spectroscopy for comprehensive structural characterization

    • Application of hydrogen-deuterium exchange mass spectrometry to map conformational changes upon activation

    • Integration of molecular dynamics simulations with experimental structural data to model receptor dynamics

    • Development of computational methods for predicting variant-specific structural perturbations

  • Advanced cellular and signaling analysis:

    • Implementation of CRISPR-Cas9 genome editing to create precise bovine cell lines with ADRA2B variants

    • Application of optogenetic and chemogenetic tools for temporal control of receptor activation

    • Utilization of enhanced FRET/BRET biosensors for real-time monitoring of receptor conformational changes

    • Development of spatial transcriptomics and proteomics to map ADRA2B-induced signaling in cellular microdomains

  • Systems biology approaches:

    • Integration of multi-omics data (transcriptomics, proteomics, metabolomics) to map ADRA2B signaling networks

    • Application of mathematical modeling for predicting complex system behaviors and identifying emergent properties

    • Development of organoid and tissue-on-a-chip technologies for studying ADRA2B function in more physiologically relevant contexts

    • Implementation of artificial intelligence and machine learning for pattern recognition in complex datasets

  • In vivo analysis enhancements:

    • Refinement of bovine transgenic models expressing reporter-tagged ADRA2B variants

    • Application of in vivo imaging techniques for visualizing receptor dynamics in intact tissues

    • Development of wireless biosensors for continuous monitoring of ADRA2B-regulated physiological parameters

    • Integration of behavioral phenotyping with molecular analyses for comprehensive functional assessment

These technological advances will likely converge to provide unprecedented insights into ADRA2B biology, bridging the gap between molecular mechanisms and physiological functions while enhancing translational applications to human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.