Recombinant Bovine Apoptosis regulator Bcl-2 (BCL2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your preparation.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BCL2; Apoptosis regulator Bcl-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPS RTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARERF ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWIQ DNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
Uniprot No.

Target Background

Function

Recombinant Bovine Apoptosis regulator Bcl-2 (BCL2) suppresses apoptosis in various cell systems, including factor-dependent lymphohematopoietic and neural cells. It regulates cell death by modulating mitochondrial membrane permeability and appears to function within a feedback loop with caspases. BCL2 inhibits caspase activity by preventing cytochrome c release from mitochondria and/or binding to apoptosis-activating factor 1 (APAF-1). Additionally, it acts as an autophagy inhibitor, interacting with BECN1 and AMBRA1 under non-starvation conditions to suppress their autophagy function. Furthermore, BCL2 may attenuate inflammation by hindering NLRP1-inflammasome activation, thereby reducing CASP1 activation and IL1B release.

Database Links
Protein Families
Bcl-2 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the role of BCL-2 in the regulation of apoptosis in bovine cells?

BCL-2 serves as a critical antiapoptotic regulator in bovine cells, functioning primarily at the mitochondrial membrane to prevent programmed cell death. Like its human counterpart, bovine BCL-2 inhibits apoptosis by regulating mitochondrial membrane permeabilization and preventing the release of cytochrome c . The protein interacts with proapoptotic molecules such as BAX, with the balance between these opposing factors determining cell survival or death .

In bovine tissues, this apoptotic regulation is particularly evident in specialized cells like binucleate cells of the placenta, where BCL-2 family proteins support placental functions throughout gestation . The antiapoptotic function is achieved through the conserved BCL-2 homology domains that enable protein-protein interactions with apoptotic effectors.

What are the conserved domains in bovine BCL-2 family proteins?

Bovine BCL-2 family proteins contain highly conserved BCL-2 homology (BH) domains that are essential for their function. Studies on bovine BCL2A1, a related antiapoptotic family member, have confirmed the presence of all four BCL-2 homology domains (BH1, BH2, BH3, and BH4) that are also found in other mammalian BCL-2 proteins . These domains are critical for:

  • BH1 and BH2: Formation of a hydrophobic groove that interacts with proapoptotic proteins

  • BH3: Mediating interactions with other BCL-2 family members

  • BH4: Contributing to the antiapoptotic function

The conservation of these domains suggests evolutionary importance in maintaining the protein's antiapoptotic function across species. The structural similarities between bovine and human BCL-2 family proteins make bovine models valuable for comparative studies of apoptotic mechanisms.

How is bovine BCL-2 expression regulated during normal cellular processes?

The regulation of bovine BCL-2 expression appears to be tissue-specific and developmentally regulated. In placental tissues, the expression of BCL2A1 (a BCL-2 family member) shows distinct temporal patterns throughout gestation. Research has demonstrated high-level expression of BCL2A1 in the bovine conceptus at Day 21 of gestation, with increasing expression in extraembryonic membrane, cotyledon, and intercotyledon tissues from implantation to term .

This regulation involves a complex interplay between proapoptotic factors (like BAX) and antiapoptotic factors (like BCL-2). The temporal patterns suggest that BCL-2 regulation is coordinated with specific developmental events:

  • Early conceptus development: High BCL2A1 expression

  • Implantation through term: Increasing expression in placental tissues

  • Late gestation to postpartum: Increased expression of proapoptotic factors (BAX, Caspase-3)

This regulated expression pattern indicates a finely tuned balance between cell survival and programmed cell death during normal bovine tissue development.

What cellular localization patterns does bovine BCL-2 exhibit?

Bovine BCL-2 family proteins, like their human counterparts, are primarily localized to the outer mitochondrial membrane where they regulate the intrinsic apoptotic pathway . This subcellular localization is critical for their function in controlling mitochondrial membrane permeabilization and the release of apoptogenic factors.

In tissue-specific contexts, the localization of bovine BCL-2 family proteins shows interesting patterns. For example, BCL2A1 expression in bovine placentomes is specifically limited to binucleate cells, which are specialized cells that express various pregnancy-specific molecules like placental lactogen . This restricted localization pattern suggests that BCL-2 family proteins have specialized functions in particular cell types within complex tissues.

How does bovine BCL-2 compare structurally to human BCL-2?

While the search results don't provide direct structural comparisons between bovine and human BCL-2 proteins, information about bovine BCL2A1 provides some insights. The cloned full-length bovine BCL2A1 cDNA contains 725 nucleotides with an open reading frame corresponding to a protein of 175 amino acids . This bovine BCL2A1 shares approximately 78% amino acid sequence homology with human BCL2A1 .

The high degree of homology suggests structural conservation between species. This is further supported by the conservation of all BCL-2 homology domains (BH1, BH2, BH3, and BH4) in bovine BCL2A1. The similarity in structure likely extends to the core BCL-2 protein as well, though direct comparative structural studies would be needed to confirm the specific differences and similarities between bovine and human BCL-2.

What techniques are most effective for studying BCL-2 function in primary bovine cell cultures?

For studying BCL-2 function in primary bovine cells, researchers have developed several effective methodological approaches:

  • Primary Cell Isolation and Culture: Bovine primary skeletal muscle cells can be isolated from fresh muscle samples (Longissimus thoracis) obtained immediately after slaughter . These cells should be cultured in appropriate media (DMEM with L-glutamine, FBS, supplements) on surfaces coated with extracellular matrix proteins like Entactin-Collagen IV-Laminin to maintain their physiological properties .

  • Cell Viability Assays: The CellTiter-Glo® Luminescent Cell Viability Assay provides quantitative measurement of ATP levels, which directly correlates with the number of metabolically active cells . This approach is valuable for assessing the protective effects of BCL-2 against apoptotic stimuli.

  • Live/Dead Viability/Cytotoxicity Assays: These assays employ dual fluorescent labeling to simultaneously detect live cells (using calcein AM, which fluoresces green in live cells) and dead cells (using ethidium homodimer-1, which enters cells with disrupted membranes and emits red fluorescence when bound to DNA) .

  • Caspase Activity Assays: Specifically, Caspase-3/7 and Caspase-9 activity assays can quantify the activation of these key apoptotic enzymes in response to experimental manipulations of BCL-2 levels or function .

These techniques provide complementary information about different aspects of apoptosis regulation by BCL-2 in bovine cells.

What role does the BCL-2/BAX ratio play in regulating apoptosis in bovine tissues?

The ratio between antiapoptotic BCL-2 family proteins and proapoptotic proteins like BAX is a critical determinant of apoptotic fate in bovine tissues. Research on bovine skeletal muscle cells has demonstrated that anoxic conditions lead to a significant increase in the Bax/Bcl-2 ratio after 6 hours, which correlates with the onset of the intrinsic apoptotic pathway .

In bovine placental tissues, the balance between BCL2A1 (antiapoptotic) and BAX (proapoptotic) appears to regulate the apoptosis of specialized binucleate cells . Both proteins are expressed in these cells, with their relative levels changing throughout gestation:

  • BCL2A1 expression: High during early conceptus development and increases in placental tissues from implantation to term

  • BAX expression: Increases with progression of gestation and remains elevated postpartum

This changing ratio suggests a mechanism for the temporal regulation of cell survival and death during placental development and function. The imbalance toward proapoptotic factors in late gestation may contribute to the normal tissue remodeling processes associated with parturition.

How does BCL-2 expression change during bovine placental development?

BCL-2 family protein expression shows distinct temporal patterns during bovine placental development. Studies focusing on BCL2A1 have revealed:

  • Early Conceptus (Day 21): High-level expression of BCL2A1 is observed

  • Implantation to Term: BCL2A1 expression increases in extraembryonic membrane, cotyledon, and intercotyledon tissues

  • Late Gestation to Postpartum: Increased expression of proapoptotic factors (BAX) and appearance of apoptotic markers (Caspase-3)

The spatial distribution of BCL2A1 is highly specific, with expression limited to binucleate cells in the placentomes . These specialized cells express various pregnancy-specific molecules and are crucial for placental function.

This regulated expression pattern suggests that BCL-2 family proteins play important roles in:

  • Maintaining the viability of specialized cell populations

  • Supporting placental functions throughout gestation

  • Contributing to the controlled apoptosis necessary for placental remodeling and delivery

How can quantitative analysis methods improve the assessment of BCL-2 expression in tissues?

Advanced quantitative analysis methods significantly enhance the evaluation of BCL-2 expression compared to conventional approaches. Research in the context of diffuse large B-cell lymphoma (DLBCL) has demonstrated the value of methodologies that integrate both the intensity and proportion of BCL-2 expression .

Two particularly effective methods include:

  • Tumor-specific automated quantitative analysis (AQUA): This method, based on multiplex immunofluorescence, provides a quantitative score that incorporates both the intensity and proportion of BCL-2 expression . In DLBCL studies, high BCL-2 AQUA scores were significantly associated with poor prognosis, independent of other prognostic factors .

  • H-scoring system: This approach adds the results of multiplying the percentage of cells with the staining intensity ordinal value, normalized to a scale of 0-100 . The H-scoring system showed similar prediction performance to the AQUA scoring system in ROC analysis .

The improvement in prognostic value demonstrates that incorporating staining intensity alongside the proportion of positive cells provides more biologically relevant information than evaluating proportion alone. This principle likely applies to the quantification of bovine BCL-2 expression as well.

How do experimental anoxic conditions affect the Bax/Bcl-2 ratio in bovine skeletal muscle cells?

Experimental anoxic conditions have been shown to significantly alter the Bax/Bcl-2 ratio in bovine primary skeletal muscle cells. Research has demonstrated that after 6 hours of anoxia, there is a significant increase in the Bax/Bcl-2 ratio, which suggests the activation of the intrinsic apoptotic pathway .

This shift in the balance between proapoptotic (BAX) and antiapoptotic (BCL-2) factors represents a molecular switch that triggers downstream apoptotic events. Following the increase in the Bax/Bcl-2 ratio, researchers observed activation of downstream caspases and other hallmarks of apoptotic cell death .

These findings illustrate how environmental stressors like oxygen deprivation can modulate the apoptotic machinery in bovine cells through alterations in the relative levels of BCL-2 family proteins. The time-dependent nature of these changes (significant after 6 hours) provides important information for designing experiments investigating apoptotic mechanisms in bovine tissues.

What protocols are recommended for isolating and culturing primary bovine cells for BCL-2 functional studies?

For isolating and culturing primary bovine cells to study BCL-2 function, the following optimized protocol has been established:

1. Tissue Collection and Processing:

  • Obtain fresh muscle samples (Longissimus thoracis/beef sirloin) immediately after slaughter from animals of the same age, gender, and breed

  • Process hot-boned fresh muscle samples at an industrial abattoir setting to ensure tissue viability

2. Culture Surface Preparation:

  • Coat tissue culture surfaces (coverslips, plates, or flasks) with 3 μl/cm² of Entactin-Collagen IV-Laminin (1 mg/ml)

  • Wash the coated surface twice with PBS before cell seeding

3. Cell Culture Conditions:

  • Growth medium: DMEM with L-glutamine (2 mM), 2% FBS, 2% Ultroser G, antibiotics (Penicillin/Streptomycin at 10,000 units/ml), and Amphotericin B (250 μg/ml)

  • Culture until 70-80% confluence (approximately 3 days)

  • For differentiation: Switch to differentiation medium (DMEM, 2% FBS, antibiotics, Amphotericin B, and 25 pmol insulin) to induce myogenesis

4. Cell Storage and Passage:

  • Store isolated cells in DMSO in liquid nitrogen until use

  • Perform experiments in the second or third cell passage, using at least three independent cell seedings for statistical validity

This protocol maintains the physiological properties of bovine cells, ensuring that studies of BCL-2 function reflect in vivo conditions as closely as possible.

What assays are most reliable for measuring apoptosis in BCL-2 expressing bovine cells?

Several complementary assays provide reliable assessment of apoptosis in bovine cells expressing BCL-2:

1. ATP-Based Cell Viability Assay:

  • The CellTiter-Glo® Luminescent Cell Viability Assay quantifies ATP levels in metabolically active cells

  • This assay generates a luminescent signal proportional to the amount of ATP present, which directly correlates with the number of viable cells

2. Live/Dead Viability/Cytotoxicity Assay:

  • This dual-fluorescence assay simultaneously identifies live and dead cells

  • Live cells: Non-fluorescent calcein AM is converted to green-fluorescent calcein by intracellular esterases

  • Dead cells: Cell-permeant ethidium homodimer-1 (EthD-1) enters cells with compromised membranes and emits red fluorescence when bound to DNA

3. Caspase Activity Assays:

  • Caspase-Glo® 3/7 Assay: Measures the activity of executioner caspases that are activated during both intrinsic and extrinsic apoptotic pathways

  • Caspase-Glo® 9 Assay: Specifically quantifies the activity of initiator caspase-9, which is activated in the intrinsic (mitochondrial) pathway downstream of BCL-2 regulation

4. TUNEL Detection:

  • Terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL) detects DNA fragmentation, a hallmark of late-stage apoptosis

  • This method has been effectively used to detect apoptosis in bovine placental tissues from late gestation to postpartum

Using multiple assays that detect different aspects of the apoptotic process provides more comprehensive insights into BCL-2 function in bovine cells.

How can BCL-2 expression be accurately quantified in bovine tissue samples?

Accurate quantification of BCL-2 expression in bovine tissue samples requires methods that account for both the intensity and proportion of expression. Based on research in other contexts, the following approaches are recommended:

1. Multiplex Immunofluorescence with AQUA Scoring:

  • The automated quantitative analysis (AQUA) scoring method based on multiplex immunofluorescence provides a quantitative measure incorporating both intensity and proportion

  • This method allows for tumor-specific analysis, distinguishing BCL-2 expression in different cell populations within heterogeneous tissues

  • AQUA scoring has demonstrated superior prognostic value compared to conventional methods that consider only the proportion of positive cells

2. H-Scoring System for Chromogenic IHC:

  • The H-scoring system adds the results of multiplying the percentage of cells with the staining intensity ordinal value

  • After normalization to a scale of 0-100, an optimal cutoff value can be determined for categorizing expression levels

  • This method has shown prediction performance similar to the more sophisticated AQUA scoring system in ROC analysis

3. In Situ Hybridization for mRNA Detection:

  • For detecting BCL-2 family gene expression at the transcriptional level, in situ hybridization provides spatial information about expression patterns

  • This technique has been successfully used to demonstrate the limited expression of BCL2A1 in binucleate cells of bovine placentomes

4. Quantitative Real-Time RT-PCR:

  • For precise quantification of BCL-2 family gene expression levels, quantitative real-time RT-PCR provides sensitive detection

  • This method has revealed the temporal expression patterns of BCL2A1 and BAX during bovine gestation

Combining protein and mRNA detection methods provides complementary information about BCL-2 expression at different regulatory levels.

What controls are necessary when evaluating bovine BCL-2 expression via immunohistochemistry?

When evaluating bovine BCL-2 expression via immunohistochemistry, several essential controls must be included to ensure reliable and interpretable results:

1. Tissue Controls:

  • Positive Tissue Control: Include bovine tissues known to express BCL-2, such as lymphoid tissues or placental binucleate cells

  • Negative Tissue Control: Include bovine tissues with minimal or no BCL-2 expression to establish baseline staining levels

2. Antibody Controls:

  • Isotype Control: Include sections stained with an irrelevant antibody of the same isotype to assess non-specific binding

  • No Primary Antibody Control: Include sections processed without the primary antibody to evaluate background staining from the detection system

3. Expression Controls:

  • Comparative Controls: Include tissues with known differential expression of BCL-2 (low, medium, high) to calibrate intensity assessment

  • Cell Type-Specific Controls: For tissues with heterogeneous cell populations, include markers to identify specific cell types expressing BCL-2

4. Analytical Controls:

  • Inter-observer Reliability: Have multiple trained individuals score the same samples to ensure consistency

  • Standardized Scoring System: Implement a rigorous quantification method that incorporates both staining intensity and proportion of positive cells

  • Image Calibration Standards: Include standardized references for calibrating imaging systems used for quantitative analysis

5. Validation Controls:

  • Correlation with Other Methods: Validate IHC findings with orthogonal methods like Western blotting or RT-PCR

  • Functional Correlation: Where possible, correlate BCL-2 expression with functional readouts of apoptosis

Implementing these controls ensures that the assessment of bovine BCL-2 expression is specific, reproducible, and biologically meaningful.

How should researchers design experiments to study the relationship between BCL-2 and cell survival in bovine models?

Designing robust experiments to study the relationship between BCL-2 and cell survival in bovine models requires careful consideration of several factors:

1. Experimental Model Selection:

  • In vitro primary cell cultures: Use bovine primary cells rather than cell lines to better reflect physiological conditions

  • Tissue-specific approach: Select appropriate cell types based on research questions (e.g., skeletal muscle cells, placental cells)

  • Developmental stage consideration: For developmental studies, ensure sampling across relevant timepoints (e.g., throughout gestation for placental studies)

2. Experimental Manipulations:

  • Stress induction: Apply relevant stressors (e.g., anoxia, nutrient deprivation, oxidative stress) to evaluate BCL-2's protective effects

  • Time-course analysis: Include multiple timepoints to capture the dynamic nature of apoptotic responses (e.g., 6h of anoxia showed significant changes in Bax/Bcl-2 ratio)

  • Dose-response studies: Vary the intensity of stressors to determine thresholds for apoptotic induction and BCL-2 protection

3. Analytical Approaches:

  • Multi-parameter assessment: Combine measurements of BCL-2 expression, caspase activation, mitochondrial integrity, and cell viability

  • Ratio analysis: Calculate and track the Bax/Bcl-2 ratio as a key indicator of apoptotic susceptibility

  • Spatial analysis: For tissue studies, employ techniques that preserve spatial information about BCL-2 expression patterns

4. Control Design:

  • Genetic controls: Where possible, use genetic approaches to manipulate BCL-2 expression levels

  • Pharmacological controls: Consider using BCL-2 inhibitors (like those developed for human BCL-2) with appropriate verification of cross-species activity

  • Statistical controls: Design experiments with adequate biological replicates (minimum three independent cell seedings) and appropriate statistical tests (e.g., two-way ANOVA)

5. Validation Strategy:

  • Cross-validation: Verify findings using multiple independent techniques

  • Physiological relevance: Correlate in vitro findings with in vivo observations where possible

  • Translational perspective: Consider the relevance of findings to both bovine physiology and comparative studies with human systems

This comprehensive experimental design approach will yield robust and reproducible insights into the role of BCL-2 in regulating cell survival in bovine models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.