Recombinant Bovine ATP synthase protein 8 (MT-ATP8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes section, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MT-ATP8; ATP8; ATPASE8; MTATP8; ATP synthase protein 8; A6L; F-ATPase subunit 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-66
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for producing ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by the electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), which contains the extramembraneous catalytic core, and F(0), which contains the membrane proton channel. These domains are linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain, ATP synthase protein 8 is a minor subunit located with subunit a in the membrane.
Gene References Into Functions
  1. Haplotypes H4 in ATP8 and H5 in ATP6 found exclusively in Tibetan yaks have been suggested to be positively associated with high-altitude adaptation. PMID: 28306370
Database Links
Protein Families
ATPase protein 8 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is bovine ATP synthase protein 8 (MT-ATP8) and what is its primary role in cellular bioenergetics?

MT-ATP8, also known as ATP synthase F0 subunit 8, MTATP8, or ATPase8, is a small protein component of the mitochondrial ATP synthase complex. This protein is approximately 8 kilodaltons in mass and forms part of the membrane-embedded F0 domain of ATP synthase, which is located in the inner mitochondrial membrane . MT-ATP8 is not directly involved in the catalytic proton transport mechanism but serves a critical structural role. It forms an α-helix that spans the membrane and protrudes into the mitochondrial matrix, positioned adjacent to subunit a and subunits i/j . The primary function of MT-ATP8 appears to be stabilizing the positioning of subunit a, which is directly involved in proton transport through the enzyme's F0 domain . This stabilization is essential for maintaining proper ATP synthase structure and function, thereby supporting efficient ATP production.

How conserved is the MT-ATP8 sequence across species, and what implications does this have for research?

The primary sequence of subunit 8 shows limited conservation across species, with only the N-terminal region displaying significant homology between humans and other mammals. According to structural analyses, despite sequence divergence, the membrane-spanning portion of subunit 8 maintains structural conservation across species . This partial conservation pattern creates both challenges and opportunities for researchers. The beginning of the yeast subunit 8 sequence shows great similarity to the human homologue, while other regions diverge considerably . This selective conservation suggests functionally critical regions at the N-terminus and potentially more flexible structural requirements elsewhere. Researchers should consider these conservation patterns when designing experiments, particularly when using model organisms or developing recombinant expression systems.

What do we currently know about MT-ATP8's structural organization within the ATP synthase complex?

Current structural data for bovine and porcine ATP synthase has resolved only the first 29 residues of subunit 8, with the C-terminal region remaining unresolved . MT-ATP8 forms an α-helical structure that spans the inner mitochondrial membrane and extends into the matrix space. It is located within the membrane part of the ATP synthase stator and is positioned adjacent to subunit a and subunits i/j . MT-ATP8 is physically distant from the c-ring, which explains why it's not directly involved in the catalytic proton transfer process. The protein likely serves a structural role in stabilizing subunit a, which is critical for proper proton channel formation between subunit a and the c-ring . This structural arrangement is essential for coupling proton transport to ATP synthesis through the rotational mechanism of ATP synthase.

What specialized techniques are required for expressing and purifying recombinant MT-ATP8?

Expression and purification of recombinant MT-ATP8 presents several technical challenges due to its small size (8 kDa), hydrophobic nature as a membrane protein, and potential toxicity when overexpressed. Based on approaches used for similar mitochondrial membrane proteins, effective expression strategies include:

  • Bacterial expression systems using specialized E. coli strains designed for membrane proteins, with fusion tags (such as MBP or SUMO) to enhance solubility

  • Cell-free expression systems that can accommodate membrane proteins

  • Yeast expression systems that provide a eukaryotic environment with appropriate post-translational modifications

Purification typically requires:

  • Detergent-based extraction from membranes

  • Affinity chromatography using epitope tags

  • Size exclusion chromatography under conditions that maintain protein stability

Researchers often need to optimize buffer conditions, detergent types, and stabilizing agents to maintain the native conformation of MT-ATP8 during purification . Commercial antibodies against MT-ATP8 are available from multiple suppliers for detection during purification processes, with applications in Western blot and other immunodetection methods .

How can researchers effectively analyze the interaction between MT-ATP8 and other ATP synthase subunits?

Understanding the interactions between MT-ATP8 and other ATP synthase subunits, particularly subunit a, requires a combination of structural and biochemical approaches:

  • Crosslinking studies can identify proximity relationships and direct interactions between subunits

  • Co-immunoprecipitation experiments using antibodies against MT-ATP8 or other subunits can identify stable interaction partners

  • Molecular dynamics simulations based on available partial structures can predict interaction interfaces

  • Mutagenesis of specific residues followed by functional assays can validate the importance of particular amino acids for subunit interactions

  • Cryo-electron microscopy has proven valuable for resolving ATP synthase structures and could be applied to further characterize MT-ATP8 interactions

Recent structural analyses of ATP synthases from different organisms have enabled comparative analysis of the membrane domains, providing insights into conserved interaction patterns despite sequence divergence . These approaches collectively help researchers understand how MT-ATP8 contributes to ATP synthase stability and function through its interactions with neighboring subunits.

What MT-ATP8 variants have been reported in patients with mitochondrial diseases?

Several variants in the MT-ATP8 gene have been identified in patients with mitochondrial diseases. The table below summarizes key variants reported in the literature:

mtDNA VariantNumber of CasesAmino Acid ChangeAssociated Disease/SyndromePathogenic Score*Database Status (MITOMAP/ClinVar)
8381A>G2T6AMIDD/LVNC cardiomyopathy0.47Reported/benign
8382C>T1T6IEpisodic paralysis0.58Reported/uncertain significance
8403T>C1I13TEpisodic weakness and progressive neuropathy0.77Reported/uncertain significance
8411A>G1M16VSevere mitochondrial disorder0.63Reported/uncertain significance

*Pathogenic scores reflect algorithmic predictions of variant pathogenicity .

These variants are primarily listed as "reported" in MITOMAP and have "uncertain significance" status in ClinVar, highlighting the ongoing challenge of definitively establishing pathogenicity for mitochondrial gene variants. The clinical manifestations range from episodic neurological symptoms to severe mitochondrial disorders and cardiomyopathy .

What experimental approaches are most informative for determining the functional consequences of MT-ATP8 variants?

Researchers employ several complementary approaches to characterize the functional impact of MT-ATP8 variants:

  • Yeast modeling: Introduction of equivalent mutations into yeast ATP8 gene allows biochemical analysis of ATP synthase function in vivo and in vitro

  • Structural modeling: Using "humanized" bovine-derived F0 domain structures where the sequence of subunit 8 is replaced with the human sequence to model the effects of specific substitutions

  • Biochemical assays: Measuring ATP synthesis rates, proton pumping efficiency, and ATP synthase assembly in model systems with introduced variants

  • Patient-derived cell studies: Analysis of ATP synthase function, mitochondrial membrane potential, and cellular bioenergetics in cells harboring MT-ATP8 variants

  • Heteroplasmy analysis: Determining the proportion of mutant to wild-type mitochondrial DNA in patient tissues, which can influence disease expression

The combination of these approaches provides comprehensive evidence regarding how specific amino acid substitutions in MT-ATP8 impact ATP synthase structure, stability, and function. This multi-faceted assessment is essential for accurate variant classification, as the low conservation of the MT-ATP8 sequence can complicate pathogenicity predictions based solely on evolutionary conservation .

How do researchers differentiate pathogenic variants from benign polymorphisms in MT-ATP8?

Distinguishing pathogenic variants from benign polymorphisms in MT-ATP8 requires integrating multiple lines of evidence:

Currently, variants in MT-ATP8 are challenging to classify due to their rarity, the heteroplasmy of mitochondrial DNA in patients' cells, and naturally occurring polymorphisms in the mitochondrial genome . Pathogenicity scores derived from computational algorithms provide initial assessments, but experimental validation is essential for definitive classification. The increasing use of NGS sequencing in diagnosis is expanding the number of reported cases, which will improve our understanding of variant significance over time .

What structural techniques have successfully resolved portions of MT-ATP8, and what are their limitations?

Cryo-electron microscopy (cryo-EM) has been the most successful technique for resolving the structure of ATP synthase complexes, including portions of MT-ATP8. In bovine and porcine ATP synthases, cryo-EM has resolved the structure of the first 29 residues of subunit 8, revealing its α-helical conformation within the membrane domain . This technique has allowed visualization of how MT-ATP8 is positioned relative to subunit a and subunits i/j in the ATP synthase complex.

  • The C-terminal region of subunit 8 remains unresolved in available structures, suggesting potential flexibility or disorder in this region

  • The resolution of membrane protein structures is often lower than that of soluble proteins due to challenges in sample preparation and imaging

  • Detergent micelles used to solubilize membrane proteins for structural studies may introduce artifacts or alter native conformations

  • The dynamic nature of ATP synthase during catalysis means static structures may not capture all functionally relevant conformations

Alternative approaches such as NMR spectroscopy for specific domains, crosslinking mass spectrometry, and hydrogen-deuterium exchange mass spectrometry could provide complementary structural information, particularly for regions that remain unresolved in cryo-EM structures.

How are computational modeling approaches being used to predict MT-ATP8 structure-function relationships?

Computational modeling has become increasingly valuable for studying MT-ATP8, particularly for:

  • Predicting the structure of unresolved regions, such as the C-terminal portion of subunit 8

  • Modeling the effects of disease-associated variants on protein structure and stability

  • Simulating interactions between MT-ATP8 and adjacent subunits in the ATP synthase complex

  • Analyzing evolutionary conservation patterns to identify functionally critical residues

Researchers have successfully used "humanized" bovine F0 domain structures, replacing the bovine subunit 8 sequence with the human sequence to model human variants . This approach allows for in silico analysis of how specific amino acid substitutions might affect protein folding, stability, and interactions with neighboring subunits.

Molecular dynamics simulations can further enhance these models by incorporating protein flexibility and membrane environments, providing insights into how variants might alter dynamic aspects of protein function. These computational approaches complement experimental studies and can guide the design of targeted functional assays to validate predictions.

What do we understand about the relationship between MT-ATP8 structure and ATP synthase assembly?

MT-ATP8's role in ATP synthase assembly appears to be primarily related to its interaction with subunit a and stabilization of the membrane domain structure. While MT-ATP8 is not directly involved in proton transport, its structural integrity is likely essential for proper positioning of subunit a, which forms part of the critical proton channel with the c-ring .

Current understanding suggests that:

  • MT-ATP8 forms part of the ATP synthase stator in the membrane domain

  • Its α-helical structure spans the membrane and extends into the matrix

  • It makes close contacts with subunit a and subunits i/j

  • This positioning likely helps maintain the correct orientation of subunit a relative to the c-ring, which is essential for proton translocation

Disruptions to MT-ATP8 structure through mutations could potentially affect ATP synthase assembly or stability by altering these critical interactions. While the primary sequence of subunit 8 is not highly conserved even between higher organisms, the structural arrangement within the complex appears to be preserved, highlighting the importance of three-dimensional structure over specific sequence in maintaining function .

What biochemical assays are most informative for analyzing MT-ATP8 function in experimental systems?

Several biochemical approaches can effectively assess MT-ATP8 function and the impact of variants:

  • ATP synthesis assays: Measuring the rate of ATP production in isolated mitochondria or submitochondrial particles can directly assess ATP synthase function

  • ATP hydrolysis assays: The reverse reaction (ATP hydrolysis) can be measured spectrophotometrically as an indicator of enzyme integrity

  • Proton pumping assays: Using pH-sensitive fluorescent dyes to monitor proton movement across membranes can assess coupling efficiency

  • Blue Native PAGE: Analyzing the assembly state of ATP synthase complexes can reveal structural defects caused by MT-ATP8 variants

  • Membrane potential measurements: Assessing the mitochondrial membrane potential using potentiometric dyes provides information about proton gradient maintenance

When studying MT-ATP8 variants in yeast models, researchers have successfully used combinations of these approaches to determine whether specific mutations affect enzyme function . These assays can detect subtle changes in ATP synthase efficiency that might not be apparent in growth phenotypes alone. The biochemical data from yeast mitochondria, for instance, indicated that the mutation equivalent to m.8403T>C was not detrimental to yeast enzyme functioning, providing valuable insights into variant pathogenicity .

What yeast-based experimental strategies have been most successful for analyzing MT-ATP8 variants?

Yeast (S. cerevisiae) has proven to be a valuable model system for studying mitochondrial gene variants, including those in MT-ATP8. Successful experimental strategies include:

  • Site-directed mutagenesis: Introduction of mutations equivalent to human variants into the yeast ATP8 gene

  • Growth phenotyping: Assessing growth on fermentable versus non-fermentable carbon sources to detect respiratory chain defects

  • Isolation of mitochondria: Purification of mitochondria from yeast strains for detailed biochemical analyses

  • In vitro enzyme activity assays: Measuring ATP synthase function in isolated mitochondrial preparations

  • Genetic complementation: Testing whether wild-type genes can rescue mutant phenotypes

Researchers have successfully used yeast to study the effects of variants in both MT-ATP6 and MT-ATP8 genes, with their research providing molecular-level understanding of how amino acid substitutions impact ATP synthase function . Despite sequence differences between yeast and human MT-ATP8, carefully designed experiments can yield valuable insights, particularly when combined with structural modeling approaches using "humanized" bovine F0 domain structures .

The primary limitation of yeast models is the divergence in MT-ATP8 sequence between species, with only the N-terminal region showing high conservation. This necessitates careful interpretation of results, particularly for variants in less-conserved regions of the protein.

What are the emerging techniques for studying the integration of MT-ATP8 function within the broader mitochondrial proteome?

Cutting-edge approaches for understanding MT-ATP8 in the context of the mitochondrial proteome include:

  • Proximity labeling techniques (BioID, APEX) to identify the neighborhood of interacting proteins around MT-ATP8

  • Mitochondrial interactome mapping using approaches like complexome profiling

  • Single-particle cryo-electron tomography to visualize ATP synthase in its native membrane environment

  • Multi-omics integration, combining proteomics, metabolomics, and transcriptomics data to understand system-level effects of MT-ATP8 variants

  • CRISPR-based mitochondrial genome editing technologies for precise manipulation of MT-ATP8 in mammalian cells

These advanced methods allow researchers to move beyond isolated protein studies to understand how MT-ATP8 variants affect mitochondrial function holistically. By mapping the network of physical and functional interactions surrounding MT-ATP8, researchers can better understand how variants in this small protein can lead to diverse clinical manifestations through cascading effects on mitochondrial homeostasis.

How are researchers addressing the challenge of heteroplasmy when studying MT-ATP8 variants?

Mitochondrial DNA heteroplasmy—the presence of both wild-type and mutant mtDNA molecules within the same cell—presents a significant challenge in studying MT-ATP8 variants. Researchers are employing several innovative approaches to address this complexity:

  • Single-cell sequencing technologies to quantify variant frequencies at the cellular level

  • Cybrid cell technology to create cell lines with controlled levels of specific MT-ATP8 variants

  • Mathematical modeling to establish threshold effects and predict phenotypic consequences at different heteroplasmy levels

  • Tissue-specific analysis to map heteroplasmy distributions across different organs in model organisms

  • Longitudinal studies to track heteroplasmy drift over time in patient samples

Understanding the relationship between heteroplasmy levels and biochemical/clinical phenotypes is crucial for accurate variant interpretation. The pathogenic potential of MT-ATP8 variants likely depends not only on the specific amino acid change but also on the proportion of mitochondria affected and tissue-specific energy demands .

What are the most promising translational applications of MT-ATP8 research for mitochondrial medicine?

MT-ATP8 research has several promising translational applications for patients with mitochondrial disorders:

  • Improved variant classification: Better functional characterization of MT-ATP8 variants will enhance diagnostic accuracy and genetic counseling

  • Development of biomarkers: Identifying reliable indicators of ATP synthase dysfunction could improve monitoring of disease progression and treatment response

  • Drug discovery: Understanding the structural basis of MT-ATP8 function could guide development of compounds that stabilize ATP synthase despite the presence of pathogenic variants

  • Gene therapy approaches: As mitochondrial genome editing technologies advance, precise correction of MT-ATP8 variants may become feasible

  • Metabolic bypass strategies: Identifying alternative energy-generating pathways that can compensate for ATP synthase dysfunction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.