Recombinant Bovine ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MNENLFTSFITPVILGLPLVTLIVLFPSLLFPTSNRLVSNRFVTLQQWMLQLVSKQMMSI HNSKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRNK TKASLAHFLPQGTPTPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLA LMSISTTTALITFTILILLTILEFAVAMIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for generating ATP from ADP in the presence of a proton gradient across the membrane. This gradient is established by electron transport complexes of the respiratory chain. F-type ATPases consist of two distinct structural domains: F(1), encompassing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. Subunit a is a key component of the proton channel, potentially playing a direct role in proton translocation across the membrane.
Gene References Into Functions
  1. Haplotypes H4 in ATP8 and H5 in ATP6, found exclusively in Tibetan yaks, were suggested to be positively associated with high-altitude adaptation. PMID: 28306370
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its role in mitochondrial function?

MT-ATP6 (mitochondrially encoded ATP synthase membrane subunit 6) is a critical component of the F₀ complex within the transmembrane F-type ATP synthase (Complex V). This enzyme catalyzes the final step of oxidative phosphorylation in the electron transport chain. One segment of ATP synthase, including the MT-ATP6 subunit, facilitates proton flow across the inner mitochondrial membrane, while another segment harnesses this energy to convert adenosine diphosphate (ADP) to adenosine triphosphate (ATP) . The MT-ATP6 protein is specifically contained within the non-catalytic, transmembrane F₀ portion of the complex and is essential for proper proton translocation during ATP synthesis .

What techniques are most effective for initial characterization of recombinant bovine MT-ATP6?

For initial characterization of recombinant bovine MT-ATP6, researchers should employ a multi-method approach:

  • SDS-PAGE analysis: Confirm protein size (expected around 24-25 kDa based on human homolog data)

  • Western blotting: Verify protein identity using specific antibodies

  • Mass spectrometry: Determine accurate molecular weight and post-translational modifications

  • Circular dichroism: Assess secondary structural elements

  • Functional reconstitution assays: Evaluate the ability to support ATP synthesis when incorporated into proteoliposomes

When working with recombinant MT-ATP6, it's crucial to maintain the protein in appropriate detergent micelles to preserve its native conformation, as this highly hydrophobic protein tends to aggregate in aqueous solutions.

What are the most effective systems for recombinant expression of bovine MT-ATP6?

Expressing recombinant MT-ATP6 presents significant challenges due to its highly hydrophobic nature and mitochondrial origin. Based on research approaches with similar membrane proteins, the following expression systems have demonstrated effectiveness:

Bacterial Expression Systems:

  • E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Expression as a fusion with solubility-enhancing tags (MBP, SUMO)

  • Codon optimization for bacterial expression

  • Inclusion of appropriate signal sequences for membrane targeting

Eukaryotic Expression Systems:

  • Insect cell (Sf9, High Five) expression using baculovirus vectors

  • Mammalian cell expression (HEK293, CHO cells)

  • Yeast expression systems (P. pastoris)

The choice of expression system should be guided by downstream applications. For structural studies requiring high protein yields, insect cell systems often provide the best balance of yield and proper folding. For functional studies, mammalian expression systems may provide more native-like post-translational modifications and protein folding.

What purification strategy provides the highest yield and purity of functional recombinant bovine MT-ATP6?

A successful purification strategy for recombinant bovine MT-ATP6 typically involves:

  • Membrane fraction isolation: Differential centrifugation to isolate membrane fractions containing the recombinant protein

  • Solubilization: Carefully optimized detergent extraction (common detergents include DDM, LMNG, or digitonin)

  • Affinity chromatography: Using engineered affinity tags (His-tag, FLAG-tag)

  • Size exclusion chromatography: To remove aggregates and achieve higher purity

  • Ion exchange chromatography: As a polishing step if necessary

Key considerations include:

  • Maintaining an appropriate detergent concentration throughout purification

  • Including lipids or lipid-like molecules to stabilize the protein

  • Working at 4°C to minimize protein degradation

  • Including protease inhibitors to prevent degradation

  • Considering nanodiscs or amphipols for downstream applications requiring detergent-free environments

What methods are most reliable for assessing the structural integrity of recombinant bovine MT-ATP6?

Several complementary approaches can be employed to assess structural integrity:

  • Circular Dichroism (CD) Spectroscopy: Evaluates secondary structure elements and can monitor thermal stability

  • Fourier-Transform Infrared Spectroscopy (FTIR): Particularly useful for analyzing membrane proteins with high α-helical content

  • Tryptophan Fluorescence: Monitors tertiary structure through intrinsic fluorescence

  • Limited Proteolysis: Properly folded proteins show distinct proteolytic patterns compared to misfolded variants

  • Cryo-EM: For higher-resolution structural analysis, especially when incorporated into the full ATP synthase complex

  • Crosslinking Mass Spectrometry: To assess protein-protein interactions within the complex

The combination of these techniques provides a comprehensive assessment of structural integrity at different levels of protein organization.

How can researchers effectively reconstitute bovine MT-ATP6 into functional proteoliposomes?

Functional reconstitution of MT-ATP6 requires careful consideration of lipid composition and reconstitution conditions:

  • Lipid selection: Mixtures mimicking mitochondrial inner membrane (e.g., phosphatidylcholine, phosphatidylethanolamine, cardiolipin)

  • Reconstitution methods:

    • Detergent removal via dialysis (gentle but time-consuming)

    • Bio-Beads adsorption (faster but potentially more disruptive)

    • Dilution method (simple but may result in heterogeneous vesicles)

  • Protein:lipid ratios: Typically 1:50 to 1:200 (w/w), requiring optimization

  • Buffer conditions: pH 7.4-8.0, physiological salt concentrations

  • Quality control: Dynamic light scattering to assess vesicle size and homogeneity

For functional studies, it's often necessary to reconstitute MT-ATP6 together with other subunits of the ATP synthase complex, as isolated MT-ATP6 alone may not display measurable activity.

What assays can accurately measure the functional activity of recombinant bovine MT-ATP6?

Functional assessment of MT-ATP6 typically requires integration into the complete ATP synthase complex or at minimum, the F₀ portion. Key assays include:

  • ATP synthesis assays: Measuring ATP production in proteoliposomes with established proton gradients

  • Proton translocation assays: Using pH-sensitive fluorescent dyes (ACMA, pyranine) to monitor proton movement

  • ATPase activity measurements: Coupled enzyme assays (with pyruvate kinase and lactate dehydrogenase)

  • Patch-clamp electrophysiology: For direct measurement of proton currents

  • Membrane potential assays: Using potential-sensitive dyes (DiSC3(5), JC-1)

When designing these assays, it's crucial to include appropriate controls:

  • Proteoliposomes without protein

  • Proteoliposomes with known inactive MT-ATP6 mutants

  • Assays performed in the presence of specific inhibitors (oligomycin, venturicidin)

How does the OXA1L-mediated insertion of MT-ATP6 function, and how can it be studied in experimental systems?

The OXA1L complex is essential for the proper co-translational insertion of MT-ATP6 into the mitochondrial inner membrane. Research indicates that defects in this process are rapidly resolved by the AFG3L2 protease complex . To study this process:

  • siRNA knockdown approaches: Silencing OXA1L and/or AFG3L2 followed by metabolic labeling can reveal the impact on MT-ATP6 synthesis and stability

  • In vitro translation systems: Using reconstituted translation systems to study nascent chain insertion

  • Fluorescent reporter fusion proteins: To monitor insertion efficiency in live cells

  • Protease protection assays: To determine correct membrane topology

  • Complementation studies: Expressing wild-type OXA1L in knockdown cells to confirm specificity

Research has shown that OXA1L inhibition leads to rapid degradation of MT-ATP6 nascent chains by the AFG3L2 protease complex, establishing an important quality control mechanism .

What is the role of the AFG3L2 protease complex in MT-ATP6 quality control, and how can researchers manipulate this system?

The AFG3L2 protease complex plays a crucial role in resolving defects in MT-ATP6 nascent chain insertion. When OXA1L-mediated insertion fails, AFG3L2 rapidly degrades these misinserted proteins . Researchers can study and manipulate this system through:

  • Genetic knockdown approaches: siRNA or CRISPR targeting of AFG3L2

  • Pharmacological inhibition: Using specific AFG3L2 inhibitors

  • Metabolic labeling: To track the fate of newly synthesized MT-ATP6 under different conditions

  • Proteomic approaches: To identify substrates and interacting partners of AFG3L2

  • Structural studies: To understand the molecular basis of substrate recognition

Experimental data indicates that double knockdown of AFG3L2 and OXA1L prevents the rapid degradation of MT-ATP6 nascent chains, confirming AFG3L2's role in this quality control pathway .

Experimental ConditionMT-ATP6 SynthesisMT-ATP6 StabilityMechanism
ControlNormalStableNormal insertion via OXA1L
OXA1L knockdownNormalUnstable (rapid degradation)Failed insertion, AFG3L2-mediated degradation
AFG3L2 knockdownNormalNormalNormal insertion, reduced degradation capacity
OXA1L + AFG3L2 double knockdownNormalAccumulation of uninserted proteinFailed insertion, impaired degradation

How do MT-ATP6 pathogenic variants affect protein function, and what are effective approaches to model these in bovine systems?

MT-ATP6 pathogenic variants can disrupt protein function through various mechanisms:

  • Frameshift mutations: Generate truncated proteins or fusion proteins, as seen with the m.8611insC and m.9205delTA variants

  • Missense mutations: Alter critical amino acids affecting proton translocation or protein-protein interactions

  • Splice site mutations: Disrupt proper mRNA processing

To model these variants in bovine systems, researchers can employ:

  • CRISPR/Cas9 genome editing: To introduce equivalent mutations in bovine cell lines

  • Recombinant expression systems: Generating mutant variants for functional studies

  • Bovine cybrid cells: Transferring mitochondria carrying specific mutations into bovine ρ⁰ cells

  • In vitro translation systems: To study the immediate effects on protein synthesis and stability

Each model system offers different advantages for studying specific aspects of MT-ATP6 pathology and should be selected based on the research question.

What are the unique challenges in studying MT-ATP6 transcript processing, and how do they impact experimental design?

MT-ATP6 presents unique challenges in transcript processing studies due to its unusual genomic organization:

  • Overlapping reading frames: MT-ATP6 has a 46-nucleotide overlap with MT-ATP8

  • Multiple transcript forms: Two transcripts exist for MT-ATP6 - a tricistronic mRNA containing MT-ATP8, MT-ATP6, and MT-CO3, and a shorter processed transcript

  • Ribosome association: Research indicates the tricistronic mRNA is the predominant form associated with mitochondrial ribosomes

These characteristics impact experimental design in several ways:

  • Northern blotting protocols: Must be optimized to distinguish between transcript variants

  • Primer design: Requires careful consideration of overlapping regions

  • Translation studies: Need to account for potential effects of upstream and downstream sequences

  • Mutation interpretation: Effects may extend beyond the annotated gene boundaries

Researchers should employ techniques like poisoned primer extension assays and strand-specific reverse transcription followed by PCR to accurately study these transcripts .

How can in vitro translation systems be optimized for studying bovine MT-ATP6 synthesis and insertion?

Optimizing in vitro translation systems for bovine MT-ATP6 requires addressing several challenges:

  • System selection:

    • Bacterial PURE systems can be used for basic translation studies

    • Mitochondrial extracts for more authentic mitochondrial translation

    • Wheat germ or rabbit reticulocyte lysates with supplemented mitochondrial factors

  • Template design considerations:

    • Including appropriate upstream and downstream sequences

    • Accounting for the overlapping reading frame with MT-ATP8

    • Using constructs that mimic the tricistronic mRNA organization

  • Co-translational insertion components:

    • Supplementing with liposomes or nanodiscs containing OXA1L

    • Including purified AFG3L2 for quality control studies

    • Adding mitochondrial inner membrane-like lipid compositions

  • Detection methods:

    • Radiolabeling with 35S-methionine/cysteine

    • Fluorescent labeling of nascent chains

    • Western blotting with specific antibodies

Research has shown that in vitro translation systems can effectively reproduce features of MT-ATP6 synthesis, including the effects of pathogenic variants on protein production .

What approaches allow researchers to study MT-ATP6's role in ATP synthase dimerization and mega-channel formation?

ATP synthase dimerization and mega-channel formation are critical aspects of mitochondrial function that involve MT-ATP6. Advanced approaches to study these phenomena include:

  • Blue Native PAGE: To resolve ATP synthase monomers, dimers, and oligomers

  • Chemical crosslinking combined with mass spectrometry: To identify interaction interfaces

  • Cryo-electron microscopy: For structural characterization of different oligomeric states

  • Atomic Force Microscopy: To visualize ATP synthase dimers in reconstituted membranes

  • Electrophysiological techniques: To study mega-channel formation and activity

  • FRET-based approaches: Using fluorescently labeled subunits to monitor dimerization dynamics

Recent research indicates that MT-ATP6 interactions are crucial for dimer formation, with supernumerary subunits like e/Atp21 playing major roles in stabilizing these structures .

How can researchers effectively investigate the interaction between MT-ATP6 and other ATP synthase subunits?

Investigating protein-protein interactions involving MT-ATP6 requires specialized approaches for membrane proteins:

  • Genetic complementation studies: Using yeast or mammalian cells with MT-ATP6 mutations

  • Co-immunoprecipitation with membrane-compatible detergents: Such as digitonin or amphipols

  • Proximity labeling approaches: BioID or APEX2 fused to MT-ATP6 or interacting partners

  • Förster Resonance Energy Transfer (FRET): For detecting direct interactions in intact membranes

  • Hydrogen-deuterium exchange mass spectrometry: To map interaction interfaces

  • Small protein interactome analysis: As demonstrated in studies identifying proteins ≤20 kDa that associate with ATP synthase

These approaches have revealed interactions between MT-ATP6 and various other subunits, including supernumerary subunits that are not essential for catalytic activity but play important roles in complex stability and regulation .

What techniques can reveal the structural dynamics of MT-ATP6 during proton translocation?

Understanding the structural dynamics of MT-ATP6 during proton translocation represents one of the most challenging areas of research. Advanced techniques include:

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR): To detect conformational changes during proton translocation

  • Single-molecule FRET: To monitor real-time conformational dynamics

  • Hydrogen-deuterium exchange mass spectrometry: To identify regions with altered solvent accessibility during functional cycles

  • Time-resolved cryo-EM: To capture different conformational states

  • Molecular dynamics simulations: To model proton movement and associated protein dynamics

  • Voltage-clamp fluorometry: Combining electrophysiological measurements with fluorescence detection of conformational changes

These techniques require careful experimental design and often benefit from complementary approaches to build a comprehensive understanding of MT-ATP6's dynamic behavior during ATP synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.