Recombinant Bovine ATPase family AAA domain-containing protein 3 (ATAD3)

Shipped with Ice Packs
In Stock

Description

Structure and Function

ATAD3A, a specific isoform, is predicted to form hexameric ring structures at the C-terminal, where the AAA+ ATPase domain is located . It spans both mitochondrial membranes, with its C terminus facing the matrix and the N-terminal region located in the outer membrane . The conserved ATPase domain, located in the C-terminal region of the protein, contains canonical residues responsible for ATP catalytic activity, including two Walker motifs (Walker A and B) and a Second Region of Homology (SRH) motif . Walker A and Walker B motifs facilitate the binding and hydrolysis of ATP, respectively .

Functionally, ATAD3A is associated with roles within mitochondria, including membrane organization, mtDNA nucleoid organization, mitochondrial translation, cholesterol trafficking, and lipid metabolism . ATAD3A is closely associated with mitochondrial membranes, supporting nucleic acid complexes at the inner membrane of the mitochondrion .

ATAD3 in Disease

  • Neurodevelopmental Disorders: Pathogenic variants in the ATAD3 gene cluster have been associated with different neurodevelopmental disorders, including hereditary spastic paraplegia (HSP) . The ATAD3 mutation (p.G355D) is associated with HSP in humans and is predicted to eliminate substrate-binding affinity, resulting in complete inactivation of the AAA protein .

  • Alzheimer's Disease (AD): ATAD3A oligomerization increases at the MAMs in various AD disease models and postmortem brains of AD patients . Immunohistochemical analysis has revealed higher ATAD3A staining in the postmortem hippocampus of AD patients compared to normal subjects . Increased ATAD3A immunodensity in NeuN-immunopositive cells has been observed in the postmortem cortex of AD patients compared to normal subjects and is consistently observed in cortical layer IV–V, the subiculum, and the hippocampus of 3-month-old 5XFAD AD mouse brains .

  • Cancer: Studies have linked ATAD3 expression with the progression of head and neck cancers, non-Hodgkin's lymphoma, and lung cancer .

ATAD3 and Mitochondrial-Associated Membranes (MAMs)

Mitochondrial sub-compartmental fractionation from mouse brains revealed ATAD3A enrichment in the MAM fractions and was present in the same mitochondrial fractions as VDAC and SigmaR1, two proteins localized to the MAMs . The distribution of ATAD3A to the MAM fraction was significantly enhanced in 5XFAD mice compared with wild-type mice . The physiological contact distance between the ER and mitochondria ranges between 10 and 30 nm, allowing the use of in situ proximity ligation assay (PLA) to assess ER-mitochondria tethering and localization of proteins on the MAMs . An increase has been observed in the number of PLA-positive puncta in 5XFAD mouse cortex and postmortem AD patient cortex relative to control samples after staining brain sections with anti-SigmaR1 and anti-VDAC antibodies .

Aberrant ATAD3A oligomerization impacts ER-mitochondria tethering, a marker of MAM integrity and activity . Downregulation of ATAD3A significantly reduces the number of PLA-positive puncta in Aβ-treated HT-22 cells stained with anti-IP3R3 and anti-VDAC antibodies or anti-SigmaR1 and anti-VDAC compared to control groups . Increased ATAD3A oligomerization is required for AD-associated MAM hyperconnectivity .

ATAD3 and Nucleoid Trafficking

An active ATPase domain is required for nucleoid trafficking, but it does not affect the interaction between ATAD3A and TFAM .

Product Specs

Buffer
For liquid delivery forms, the protein is supplied in a Tris/PBS-based buffer containing 5-50% glycerol. Glycerol concentration may be customized upon request; please specify your requirements during order placement.
Form
This protein is available in liquid or lyophilized powder form. While we prioritize shipping the format currently in stock, specific format requests will be accommodated; please indicate your preference during order placement.
Lead Time
Orders typically ship within 1-3 business days of receipt. Delivery times may vary depending on shipping method and destination. Please contact your local distributor for precise delivery estimates. Shipping is standard with blue ice packs; dry ice shipping is available upon request and incurs an additional charge.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Liquid formulations generally have a 6-month shelf life at -20°C/-80°C, while lyophilized preparations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tag
Synonyms
ATAD3; ATPase family AAA domain-containing protein 3
Datasheet & Coa
Please contact us to get it.
Expression Region
2-586
Protein Length
Full Length of Mature Protein
Source
in vitro E.coli expression system
Species
Bos taurus (Bovine)
Target Names
ATAD3
Target Protein Sequence
SWLFGIKGSKGEGTGPPLPLPPVQPGGEGSGDGGAGDRPGPKDKWSNFDPTGLERAAKA ARELEHSRHAKEALSLAQMQEQTLQLEHQAKLKEYEAAVEQLKGDQIRVQAEERRKTLSE ETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEALRRATVEREMELR HKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTILESIRTAGTLFGEGFRAFV TDWDKVTATVAGLTLLAVGIYSAKNATSVAGRYIEARLGKPSLVRETSRITVLEALRHPI QVSRRLLSKPQDALEGVVLSPSLEARVRDIAIATRNTKKNKSLYRNVLMYGPPGTGKTLF AKKLALHSGMDYAIMTGGDVAPMGRDGVTAMHKVFDWASTSRRGLLLFVDEADAFLRKRA TEKISEDLRATLNAFLHRTGQHSSKFMLVLASNQPEQFDWAINDRIDEMVSFELPQREER ERLVRMYFDKYVLKPATEGKQRLKLAQFDYGKKCSEIAQLTEGMSGREISQLAVAWQAMA YASEDGVLTEAMMDARVQDAIQQHRQKMQWLKAEGSQPPTLRTQAE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
ATAD3A is crucial for mitochondrial network organization, mitochondrial metabolism, and cellular growth at both the organismal and cellular levels. It plays a significant role in mitochondrial protein synthesis and may also participate in mitochondrial DNA replication. Evidence suggests it binds to mitochondrial DNA D-loops, contributing to nucleoid stability. Additionally, ATAD3A is involved in enhanced cholesterol channeling for hormone-dependent steroidogenesis and mitochondrial-mediated antiviral innate immunity.
Gene References Into Functions
  1. ATAD3A positively regulates milk protein, fat, and lactose biosynthesis, and cell proliferation in mammary epithelial cells. PMID: 29286187
Database Links
Protein Families
AAA ATPase family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion matrix, mitochondrion nucleoid.

Q&A

What is the structural difference between ATAD3A and ATAD3B proteins?

Human ATAD3A and ATAD3B share high sequence homology, but ATAD3B contains 62 additional amino acids at its C-terminus compared to ATAD3A. This C-terminal extension of ATAD3B contains a unique LIR (LC3-interacting region) motif that is absent in ATAD3A. The LIR motif enables ATAD3B to bind to LC3 and initiate mitophagy during oxidative stress. Both proteins contain N-terminal domains that extend into the intermembrane space (IMS) and C-terminal AAA-ATPase domains that are exposed to the mitochondrial matrix where mtDNA is located .

The protein structure of ATAD3A includes an N-terminal half (IMS domain: amino acids 1-250) and a C-terminal half (matrix domain: amino acids 245-586). Similarly, ATAD3B shares this domain organization but contains the additional C-terminal region with the functional LIR motif that enables its unique role as a mitophagy receptor .

How is ATAD3 distributed across different tissues?

ATAD3A is ubiquitously expressed in human tissues and serves as the major variant in many cell types, including HeLa cells. ATAD3B demonstrates a more selective expression pattern. According to the Human Proteome Map database, ATAD3B is moderately expressed in various adult tissues, including the frontal cortex, retina, liver, ovary, testis, pancreas, and B cells .

Interestingly, ATAD3B is highly expressed in human embryonic stem cells, suggesting an important role during development and cell differentiation. This tissue-specific distribution pattern may reflect specialized functions of ATAD3B in different cellular contexts, particularly in tissues with high mitochondrial content or metabolic demands .

What are the main functional domains of ATAD3 and their roles?

ATAD3 proteins contain several key functional domains:

  • N-terminal domain (IMS domain): Located in the intermembrane space, this domain (amino acids 1-250 in ATAD3A) is involved in membrane association and potentially in interactions with other mitochondrial proteins.

  • C-terminal AAA-ATPase domain (matrix domain): Located in the mitochondrial matrix (amino acids 245-586 in ATAD3A), this domain directly interacts with nucleoids through binding to TFAM (mitochondrial transcription factor A). The AAA-ATPase domain provides the energy for various cellular activities through ATP hydrolysis .

  • Coiled-coil domain: Present in both ATAD3A and ATAD3B, this domain mediates protein-protein interactions and is crucial for the formation of homo-oligomers and hetero-oligomers between ATAD3A and ATAD3B .

  • LIR motif: Unique to ATAD3B's C-terminal extension, this motif (containing residues Y604 and L607) binds to LC3B and is essential for ATAD3B's function as a mitophagy receptor during oxidative stress .

How does ATAD3A interact with mitochondrial DNA nucleoids?

ATAD3A interacts with mitochondrial DNA nucleoids through its C-terminal AAA-ATPase domain, which directly binds to TFAM (mitochondrial transcription factor A). TFAM is a key component of nucleoids that packages and organizes mtDNA. In vitro binding assays have demonstrated that the C-terminal AAA domain of ATAD3A efficiently interacts with TFAM .

Specifically, TFAM contains two HMG box domains (HMG box A and B) for mtDNA binding and packaging, and a C-terminal domain that enhances transcription. The C-terminal domain of TFAM enhances its interaction with ATAD3A, although TFAM without this domain can still interact with the C-terminal AAA domain of ATAD3A, albeit with reduced efficiency .

Through this interaction with TFAM, ATAD3A regulates the size and number of mtDNA nucleoids. Knockdown of ATAD3A results in remarkably smaller nucleoid signals under fluorescence microscopy, highlighting its crucial role in maintaining nucleoid integrity .

What experimental approaches are commonly used to study ATAD3 localization in cells?

Several experimental approaches are employed to study ATAD3 localization in cells:

  • Immunofluorescence microscopy: Using specific antibodies against ATAD3A or ATAD3B, researchers can visualize their localization in fixed cells. Co-staining with mitochondrial markers (such as Tom20) or nucleoid markers (such as anti-DNA antibodies or anti-TFAM antibodies) allows for the assessment of ATAD3 colocalization with these structures .

  • Submitochondrial fractionation: This technique separates different mitochondrial compartments (outer membrane, intermembrane space, inner membrane, and matrix) to determine the precise submitochondrial localization of ATAD3 proteins. Proteinase K protection assays can be used to assess which portions of ATAD3 are exposed to different compartments .

  • Proteinase K accessibility assay: By treating isolated mitochondria with increasing concentrations of proteinase K, researchers can determine which portions of ATAD3 are exposed on the outer mitochondrial membrane. This approach revealed that upon oxidative stress (H₂O₂ treatment), a certain proportion of ATAD3B localizes to the outer mitochondrial membrane, whereas ATAD3A remains protected .

  • Recombinant protein expression with fluorescent tags: Expression of ATAD3 variants fused with fluorescent proteins (such as GFP or mCherry) allows for live-cell imaging and dynamic analysis of ATAD3 localization and movement within mitochondria .

How does ATAD3B promote oxidative stress-induced mitophagy?

ATAD3B promotes oxidative stress-induced mitophagy through a multi-step mechanism:

This mechanism is PINK1-independent, distinguishing it from other well-characterized mitophagy pathways and highlighting ATAD3B's unique role as a mitophagy receptor specifically responding to oxidative stress .

What is the mechanism of ATAD3A's regulation of mitochondrial nucleoid dynamics?

ATAD3A regulates mitochondrial nucleoid dynamics through several mechanisms:

  • Direct interaction with TFAM: ATAD3A directly interacts with TFAM through its C-terminal AAA domain. TFAM is a key component of nucleoids that packages and organizes mtDNA. This interaction is enhanced by the C-terminal domain of TFAM, which also enhances transcription .

  • ATP-dependent nucleoid trafficking: The ATPase activity of ATAD3A's AAA domain provides energy for the dynamic movements of nucleoids. This is crucial for proper nucleoid distribution within the mitochondrial network .

  • Regulation of nucleoid size and number: Knockdown of ATAD3A results in remarkably smaller nucleoid signals under fluorescence microscopy, indicating that ATAD3A is essential for maintaining proper nucleoid morphology. This suggests that ATAD3A plays a role in nucleoid aggregation or organization .

  • Nucleoid clustering in fission-deficient cells: ATAD3A regulates the active trafficking of nucleoids, which is dependent on its ATPase and coiled-coil domains. This trafficking is particularly important in mitochondrial fission-deficient cells, where nucleoid clustering is observed .

  • Maintenance of respiratory complexes: The regulation of nucleoid dynamics by ATAD3A is crucial for the maintenance of respiratory complexes on the mitochondrial inner membrane, linking nucleoid organization to mitochondrial function .

These mechanisms collectively demonstrate ATAD3A's critical role in organizing and maintaining the integrity of mitochondrial nucleoids, which is essential for proper mitochondrial function and cellular homeostasis.

How do ATAD3A and ATAD3B interact to form oligomers, and what is the functional significance?

ATAD3A and ATAD3B interact to form various oligomeric structures with distinct functional implications:

  • Hetero-oligomerization: ATAD3A and ATAD3B can form hetero-oligomers through their coiled-coil domains. Co-immunoprecipitation analysis has confirmed that ATAD3A directly interacts with ATAD3B .

  • Homo-oligomerization: Both ATAD3A and ATAD3B can independently form homo-oligomers, suggesting that they may have distinct functions when assembled as homogeneous complexes .

  • Predominance of hetero-oligomers: ATAD3A-ATAD3B hetero-oligomers appear to be the primary forms of ATAD3 oligomers in cells. Loss of either ATAD3A or ATAD3B dramatically decreases the formation of ATAD3 oligomers, highlighting the interdependence of these proteins .

The functional significance of these oligomeric arrangements includes:

Understanding these oligomeric interactions provides insight into how ATAD3 proteins coordinate their functions in mitochondrial nucleoid organization and mitophagy regulation.

What is the role of ATAD3B in hypoxia-induced mitophagy?

ATAD3B plays a crucial role in promoting hypoxia-induced mitophagy through the following mechanisms:

  • Response to hypoxia-induced oxidative stress: Hypoxic conditions significantly increase mitochondrial ROS (mtROS) production in cells, leading to oxidative stress. This creates an environment where ATAD3B can function as a mitophagy receptor .

  • Facilitation of mitochondrial clearance: In response to hypoxia, ATAD3B knockout or knockdown leads to a remarkable decrease in hypoxia-induced mitophagy, as demonstrated by mito-Keima assays. Conversely, ATAD3B-Flag expression causes a marked increase in hypoxia-induced mitophagy .

  • Integration with hypoxia-response pathways: While other proteins like FUNDC1 and NIX/BNIP3 are known to mediate hypoxia-induced mitophagy, ATAD3B provides an additional pathway specifically responding to the oxidative stress component of hypoxia .

  • Potential therapeutic implications: ATAD3B's role in hypoxia-induced mitophagy may have therapeutic implications for conditions involving tissue hypoxia, such as ischemic injuries or certain cancers, where proper mitochondrial quality control is essential for cell survival or death decisions .

This function of ATAD3B in hypoxia-induced mitophagy reveals its importance in cellular adaptation to oxygen limitation, potentially providing a novel target for therapeutic interventions in hypoxia-related pathologies.

How does the ATAD3B-ATAD3A-mtDNA axis sense mitochondrial DNA damage?

The ATAD3B-ATAD3A-mtDNA axis senses and responds to mitochondrial DNA damage through a coordinated mechanism:

  • Indirect mtDNA binding by ATAD3B: While ATAD3A can directly bind to mtDNA, ATAD3B likely interacts with mtDNA indirectly through hetero-oligomerization with ATAD3A. Both ATAD3A and ATAD3B have been found to bind to mtDNA, forming the ATAD3B-ATAD3A-mtDNA axis .

  • Response to mtDNA lesions: When mtDNA is damaged by oxidative stress (H₂O₂ or 3-NPA treatment), it results in mitochondrial dysfunction and increased ROS production. This damage is sensed by the ATAD3B-ATAD3A-mtDNA complex .

  • Altered protein interactions: mtDNA damage and subsequent oxidative stress lead to decreased interaction between ATAD3B and ATAD3A. This change in protein association may serve as a molecular switch that activates ATAD3B's mitophagy-promoting function .

  • Submitochondrial relocalization: Following mtDNA damage, a portion of ATAD3B relocates from the inner mitochondrial membrane to the outer mitochondrial membrane. This relocalization exposes ATAD3B's LIR motif to the cytoplasm, allowing it to recruit LC3 and initiate mitophagy .

  • Selective removal of damaged mtDNA: Through this sensing mechanism, ATAD3B promotes the selective clearance of mitochondria containing damaged mtDNA, potentially serving as a quality control mechanism to prevent the accumulation of mtDNA mutations .

This axis represents a sophisticated surveillance system that connects mtDNA integrity to mitochondrial quality control through mitophagy, highlighting the importance of ATAD3 proteins in maintaining mitochondrial genomic stability.

What are the optimal protocols for expressing and purifying recombinant ATAD3 proteins?

Optimal protocols for expressing and purifying recombinant ATAD3 proteins include:

  • Bacterial expression systems: For in vitro biochemical studies, ATAD3 domains can be expressed in E. coli as fusion proteins. For example, the N-terminal half (IMS domain: amino acids 1-250) or C-terminal half (matrix domain: amino acids 245-586) of ATAD3A can be expressed as GST-fusion proteins. Similarly, TFAM variants can be expressed with a His-tag and mCherry for interaction studies .

  • Purification strategies:

    • For GST-fusion proteins: Glutathione beads can be used for affinity purification

    • For His-tagged proteins: Ni-chelating beads are effective for purification

  • Stability considerations: It's important to note that recombinant ATAD3 proteins, particularly the GST-fused ATAD3A variants, can be unstable and prone to aggregation after extraction from affinity beads. Therefore, immediate use after purification or addition of stabilizing agents may be necessary .

  • Alternative approach for interaction studies: Due to protein instability issues, interactions between ATAD3 variants and binding partners can be examined under fluorescence microscopy by observing fluorescent tag (e.g., mCherry) signals on affinity beads coated with the protein of interest. This approach was successfully used to demonstrate the interaction between the C-terminal AAA domain of ATAD3A and TFAM variants .

  • Mammalian expression systems: For cellular studies, ATAD3 variants can be expressed in mammalian cells (e.g., HeLa, 293T) as tagged proteins (Flag-tagged, GFP-tagged) to study their localization, interactions, and functions in a more physiologically relevant context .

These protocols provide a foundation for studying ATAD3 proteins in vitro and in cellular contexts, enabling detailed biochemical and functional analyses.

How can researchers effectively knockdown ATAD3 expression for functional studies?

Researchers can effectively knockdown ATAD3 expression using several approaches:

  • RNA interference (RNAi): Small interfering RNA (siRNA) designed to target ATAD3A and ATAD3B can effectively repress ATAD3 protein levels. In HeLa cells, where ATAD3A is the major variant expressed, siRNA targeting both ATAD3A and ATAD3B has been successfully used to achieve knockdown. Immunoblotting can confirm the repression of ATAD3 variants .

  • CRISPR-Cas9 genome editing: For complete knockout studies, CRISPR-Cas9 can be used to generate ATAD3A knockout (KO), ATAD3B KO, or ATAD3 double knockout (DKO) cell lines. This approach provides a clean genetic background for studying the specific functions of each ATAD3 variant .

  • Validation of knockdown efficiency:

    • Western blotting with antibodies against ATAD3 variants

    • Quantitative PCR to measure mRNA levels

    • Immunofluorescence microscopy to visualize the loss of ATAD3 signal in cells

  • Rescue experiments: To confirm the specificity of knockdown phenotypes, expression of siRNA-resistant ATAD3 variants (with silent mutations in the siRNA target sequence) can be used for rescue experiments. For example, ATAD3B-Flag expression in ATAD3 DKO cells has been shown to dramatically increase mitophagy levels upon oxidative stress treatment, confirming ATAD3B's specific role in this process .

  • Considerations for cellular phenotypes: ATAD3A KO can cause slight mitophagy under normal conditions, likely due to mitochondrial dysfunction resulting from ATAD3A depletion. This baseline effect should be considered when interpreting results from knockout or knockdown experiments .

These approaches provide researchers with effective tools to modulate ATAD3 expression levels for functional studies, enabling the dissection of ATAD3 variant-specific roles in mitochondrial biology.

What imaging techniques are most effective for visualizing ATAD3-nucleoid interactions?

Several imaging techniques are particularly effective for visualizing ATAD3-nucleoid interactions:

  • Confocal microscopy:

    • Immunofluorescence using antibodies against ATAD3 variants (ATAD3A, ATAD3B) and nucleoid components (anti-DNA antibodies, anti-TFAM antibodies)

    • Colocalization analysis to quantify the spatial overlap between ATAD3 and nucleoid signals

    • This approach has been successfully used to observe remarkably smaller nucleoid signals in ATAD3 knockdown cells .

  • Live-cell imaging with fluorescent protein fusions:

    • Expression of ATAD3 variants fused with fluorescent proteins (e.g., GFP, mCherry)

    • Staining of nucleoids with DNA-specific dyes or expression of fluorescently tagged nucleoid components (e.g., TFAM-GFP)

    • Time-lapse imaging to capture dynamic interactions and movements of ATAD3 and nucleoids

    • This approach allows for real-time visualization of nucleoid trafficking regulated by ATAD3A .

  • Super-resolution microscopy:

    • Techniques such as STED (Stimulated Emission Depletion), STORM (Stochastic Optical Reconstruction Microscopy), or PALM (Photoactivated Localization Microscopy)

    • These methods overcome the diffraction limit of conventional microscopy, providing nanometer-scale resolution

    • Particularly useful for resolving the precise spatial relationship between ATAD3 and nucleoid components within the confined space of mitochondria

  • Correlative light and electron microscopy (CLEM):

    • Combines fluorescence microscopy with electron microscopy

    • Allows for the correlation of fluorescent signals (ATAD3, nucleoids) with ultrastructural features of mitochondria

    • Provides context for understanding how ATAD3-nucleoid interactions relate to mitochondrial membrane structures

  • In vitro fluorescence microscopy:

    • For biochemical interaction studies, fluorescently tagged proteins (e.g., mCherry-TFAM) can be observed on glutathione beads coated with GST-fused ATAD3 variants

    • This approach was successfully used to demonstrate the interaction between the C-terminal AAA domain of ATAD3A and TFAM variants .

These imaging techniques, used individually or in combination, provide powerful tools for visualizing and quantifying ATAD3-nucleoid interactions, contributing to our understanding of ATAD3's role in nucleoid organization and dynamics.

How can researchers measure ATAD3-mediated mitophagy in cellular models?

Researchers can measure ATAD3-mediated mitophagy in cellular models using several complementary approaches:

  • Mito-Keima assay:

    • Mito-Keima is a pH-sensitive fluorescent protein targeted to mitochondria

    • It exhibits a shift in excitation spectrum when mitochondria are delivered to acidic lysosomes during mitophagy

    • This assay has been successfully used to demonstrate that ATAD3B knockdown leads to a remarkable decrease in hypoxia-induced mitophagy, while ATAD3B-Flag expression causes a marked increase .

  • Confocal microscopy and flow cytometry analysis:

    • Visualization and quantification of mitochondrial clearance in cells treated with oxidative stress inducers (H₂O₂, 3-NPA)

    • Comparison between control cells and cells with ATAD3 variant knockdown or overexpression

    • This approach revealed that ATAD3 knockdown has an effect similar to ATG5 knockdown (an essential autophagy gene) on H₂O₂-induced mitophagy .

  • Co-localization analysis of mitochondria and autophagosomes/lysosomes:

    • Immunofluorescence staining of mitochondrial markers (e.g., Tom20) and autophagosome/lysosome markers (e.g., LC3, LAMP1)

    • Quantification of co-localization events to measure the delivery of mitochondria to the autophagy pathway

    • This approach can reveal the recruitment of autophagosomes to mitochondria mediated by ATAD3B's LIR motif .

  • Biochemical analysis of mitochondrial protein degradation:

    • Western blotting to measure the levels of mitochondrial proteins (e.g., Tom20, COXIV) as indicators of mitochondrial mass

    • Treatment with lysosomal inhibitors (e.g., Bafilomycin A1) to confirm that protein degradation occurs through the autophagy-lysosome pathway

    • This approach can provide quantitative data on the extent of mitophagy mediated by ATAD3 variants .

  • Analysis of mtDNA levels and integrity:

    • Quantitative PCR to measure mtDNA copy number

    • Detection of mtDNA lesions using PCR-based techniques

    • This approach can assess how ATAD3-mediated mitophagy affects the clearance of damaged mtDNA, particularly in cells with mtDNA mutations like m.3243A>G .

These methods provide comprehensive tools for measuring ATAD3-mediated mitophagy in cellular models, enabling researchers to dissect the mechanisms and functional significance of this process in mitochondrial quality control.

What assays are available to study ATAD3's ATPase activity?

Several assays are available to study ATAD3's ATPase activity:

  • Colorimetric ATPase assays:

    • Malachite green assay: Measures the release of inorganic phosphate (Pi) from ATP hydrolysis

    • The assay can be performed using purified recombinant ATAD3 AAA domain to measure its intrinsic ATPase activity

    • Effects of various conditions (pH, temperature, ion concentrations) or potential inhibitors on ATPase activity can be assessed

  • Radioactive ATPase assays:

    • Using [γ-³²P]ATP as substrate and measuring the release of ³²Pi

    • This highly sensitive method can detect even low levels of ATPase activity

    • Particularly useful for kinetic studies of ATAD3's ATPase function

  • Coupled enzyme assays:

    • ATP hydrolysis can be coupled to the oxidation of NADH, which can be monitored spectrophotometrically

    • For example, the pyruvate kinase/lactate dehydrogenase coupled assay links ATP hydrolysis to NADH oxidation

    • This provides a continuous real-time measurement of ATPase activity

  • ATPase activity in the context of nucleoid dynamics:

    • Expression of ATPase-deficient ATAD3 mutants (e.g., Walker A or Walker B mutations in the AAA domain)

    • Analysis of nucleoid morphology, size, and distribution in cells expressing these mutants compared to wild-type ATAD3

    • This approach can reveal how ATAD3's ATPase activity contributes to its function in regulating nucleoid dynamics .

  • Structure-function analysis:

    • Site-directed mutagenesis of key residues in the AAA domain

    • Comparing the ATPase activity of wild-type and mutant ATAD3 proteins

    • Correlating changes in ATPase activity with functional outcomes in cellular assays

    • This approach can identify critical residues for ATAD3's enzymatic function and provide insights into its mechanism of action.

These assays provide complementary approaches to study ATAD3's ATPase activity, from biochemical characterization of its enzymatic properties to functional analysis of how this activity contributes to ATAD3's roles in nucleoid dynamics and mitochondrial function.

How is ATAD3 dysfunction linked to mitochondrial diseases?

ATAD3 dysfunction is linked to mitochondrial diseases through several mechanisms:

  • ATAD3 gene cluster deletions: Deletions in the ATAD3 gene cluster have been associated with fatal congenital pontocerebellar hypoplasia and aberrant mtDNA organization. This highlights the critical role of ATAD3 proteins in neurological development and mtDNA maintenance .

  • Mitochondrial DNA integrity: ATAD3 proteins, particularly ATAD3A, are essential for maintaining proper nucleoid morphology and organization. Dysfunction in ATAD3 can lead to alterations in mtDNA integrity, contributing to mitochondrial diseases associated with mtDNA mutations or deletions .

  • Impaired mitophagy: ATAD3B functions as a mitophagy receptor that promotes the clearance of damaged mtDNA during oxidative stress. In mitochondrial diseases associated with mtDNA mutations (such as MELAS syndrome with the m.3243A>G mutation), ATAD3B expression is reduced, potentially impairing the cell's ability to eliminate damaged mitochondria .

  • Heteroplasmy in mitochondrial diseases: Many patients with mitochondrial diseases contain a mixture of wild-type and mutated mtDNA (heteroplasmy). When the percentage of mutated mtDNA exceeds a threshold (typically >50%), cellular defects and disease symptoms emerge. ATAD3 dysfunction may contribute to the accumulation of mutated mtDNA by impairing mechanisms that would normally eliminate these damaged genomes .

  • Respiratory complex maintenance: ATAD3A's regulation of nucleoid dynamics is crucial for the maintenance of respiratory complexes on the mitochondrial inner membrane. Disruption of this function can lead to impaired oxidative phosphorylation and energy production, a common feature of mitochondrial diseases .

These connections between ATAD3 dysfunction and mitochondrial diseases highlight the potential of ATAD3 as a therapeutic target for treating or preventing these often devastating disorders.

How do mutations in ATAD3 genes affect mitochondrial function?

Mutations in ATAD3 genes affect mitochondrial function through several mechanisms:

  • Disruption of nucleoid organization: ATAD3A regulates the size and number of mtDNA nucleoids. Mutations that impair this function can lead to abnormal nucleoid morphology, potentially affecting mtDNA replication, transcription, and maintenance. In ATAD3 knockdown cells, remarkably smaller nucleoid signals are observed under fluorescence microscopy .

  • Impaired respiratory function: ATAD3A's regulation of nucleoid dynamics is crucial for the maintenance of respiratory complexes on the mitochondrial inner membrane. Mutations that disrupt this function can lead to compromised oxidative phosphorylation and ATP production, resulting in energy deficiency in affected tissues .

  • Defects in mitophagy: ATAD3B functions as a mitophagy receptor during oxidative stress. Mutations in the LIR motif (Y604 and L607) or other functional domains of ATAD3B can impair its ability to bind to LC3B and initiate mitophagy, potentially leading to the accumulation of damaged mitochondria and mtDNA .

  • Altered oligomerization: ATAD3A and ATAD3B form hetero-oligomers that represent the primary forms of ATAD3 oligomers in cells. Mutations that disrupt these interactions can affect the formation and function of these complexes, potentially impairing their roles in nucleoid organization and mitophagy .

  • Developmental abnormalities: ATAD3 gene cluster deletions are associated with fatal congenital pontocerebellar hypoplasia, indicating that ATAD3 proteins play critical roles in neurological development. Mutations that affect ATAD3 function during development can lead to severe developmental abnormalities .

  • Increased oxidative stress: ATAD3A depletion or dysfunction itself leads to mitochondrial dysfunction, which may increase reactive oxygen species (ROS) production and oxidative stress. This creates a vicious cycle of mitochondrial damage and dysfunction that can contribute to disease pathogenesis .

Understanding how specific mutations in ATAD3 genes affect mitochondrial function provides insights into the molecular mechanisms underlying ATAD3-associated diseases and may guide the development of targeted therapeutic strategies.

What are the challenges in developing ATAD3-targeted therapeutic approaches?

Developing ATAD3-targeted therapeutic approaches faces several significant challenges:

  • Dual localization and multiple functions: ATAD3 proteins have complex submitochondrial localization patterns and multiple functions. ATAD3A primarily localizes to the inner mitochondrial membrane with roles in nucleoid organization, while ATAD3B can relocate to the outer membrane during stress to promote mitophagy. Targeting specific functions without disrupting others presents a significant challenge .

  • Isoform-specific targeting: ATAD3A and ATAD3B share high sequence homology but have distinct functions. Developing therapeutics that selectively target or enhance specific isoform activities (e.g., ATAD3B's mitophagy-promoting function) without affecting others requires highly specific approaches .

  • Balancing mitophagy induction: While enhancing ATAD3B-mediated mitophagy might be beneficial for clearing mutated mtDNA, excessive mitophagy could potentially lead to mitochondrial depletion and energy deficiency. Finding the right balance for therapeutic benefit without causing harm is challenging .

  • Tissue-specific expression patterns: ATAD3B shows tissue-specific expression patterns, being moderately expressed in various adult tissues including the frontal cortex, retina, liver, ovary, testis, pancreas, and B cells. Therapeutic approaches may need to account for these tissue-specific expression patterns to achieve desired effects in target tissues .

  • Delivery to mitochondria: Delivering therapeutic agents specifically to mitochondria and across mitochondrial membranes represents a significant challenge in drug development. This is particularly relevant for targeting ATAD3 proteins, which have complex membrane topology .

  • Timing of intervention: For preventive approaches in mitochondrial diseases, determining the optimal timing for intervention is crucial. This is particularly relevant for preventing the distribution of maternal mutated mtDNA during reproductive development and stem cell differentiation .

  • Limited understanding of disease mechanisms: While progress has been made in understanding ATAD3's functions, many aspects of how ATAD3 dysfunction leads to specific disease phenotypes remain unclear. More research is needed to fully elucidate these mechanisms to guide therapeutic development .

Addressing these challenges will require innovative approaches and continued research into ATAD3 biology, but the potential benefits for patients with mitochondrial diseases make these efforts worthwhile.

How does ATAD3 expression change in response to different cellular stressors?

ATAD3 expression and function change dynamically in response to various cellular stressors:

  • Oxidative stress response:

    • Upon H₂O₂ or 3-NPA treatment, a portion of ATAD3B relocates from the inner mitochondrial membrane to the outer mitochondrial membrane, exposing its LIR motif to the cytoplasm

    • This relocalization enables ATAD3B to bind to LC3B and promote mitophagy

    • The interaction between ATAD3A and ATAD3B decreases during oxidative stress, potentially facilitating this relocalization .

  • Hypoxia response:

    • Hypoxia leads to increased mitochondrial ROS production, creating oxidative stress in cells

    • ATAD3B promotes hypoxia-induced mitophagy, with knockdown leading to decreased mitophagy and overexpression causing increased mitophagy under hypoxic conditions

    • This response may be particularly important in pathological conditions involving tissue hypoxia .

  • Altered expression in disease states:

    • In cells carrying the m.3243A>G mutation (associated with MELAS syndrome) and in human MELAS patient-derived fibroblasts, ATAD3B expression is reduced

    • This deficiency may contribute to the inability of these cells to efficiently clear damaged mitochondria through mitophagy

    • Re-expression of ATAD3B in these cells can reduce the proportion of mutated mtDNA .

  • Developmental regulation:

    • ATAD3B is highly expressed in human embryonic stem cells but shows more selective expression in adult tissues

    • This suggests developmental regulation of ATAD3B expression, potentially reflecting its importance in maintaining mtDNA integrity during cell differentiation .

  • Interaction changes during stress:

    • Under normal conditions, ATAD3A and ATAD3B form hetero-oligomers

    • During oxidative stress, decreased interaction between ATAD3A and ATAD3B may serve as a molecular switch that activates ATAD3B's mitophagy-promoting function .

Understanding these dynamic changes in ATAD3 expression and function in response to cellular stressors provides insights into how ATAD3 proteins contribute to mitochondrial quality control and cellular adaptation to stress. This knowledge may guide the development of therapeutic strategies that modulate ATAD3 function in specific stress conditions or disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.