Recombinant Bovine Bcl10-interacting CARD protein

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Bcl10-interacting CARD Protein

The Recombinant Bovine Bcl10-interacting CARD protein, also known as BinCARD, is a protein that interacts with Bcl10, a key component in the NF-κB signaling pathway. This pathway is crucial for immune responses, including inflammation and cell survival. BinCARD is notable for its ability to inhibit Bcl10-mediated activation of NF-κB, thereby modulating immune responses.

Structure and Function of BinCARD

BinCARD contains a caspase recruitment domain (CARD), which is essential for its interaction with Bcl10. The CARD domain allows BinCARD to bind to Bcl10, preventing its oligomerization and subsequent activation of NF-κB . This interaction is critical for regulating immune cell activation and preventing excessive inflammation.

Mechanism of Action

BinCARD's mechanism of action involves inhibiting the phosphorylation of Bcl10, a necessary step for NF-κB activation. By preventing Bcl10 phosphorylation, BinCARD suppresses the downstream signaling that leads to NF-κB activation . This regulatory function is important for maintaining immune homeostasis and preventing autoimmune diseases.

Research Findings

Several studies have highlighted the role of BinCARD in modulating immune responses. For instance, mutations in the CARD domain of BinCARD, specifically at residues Leu17 or Leu65, abolish its inhibitory effects on Bcl10-induced NF-κB activation . This underscores the importance of the CARD domain in BinCARD's function.

Comparison with Other CARD-containing Proteins

BinCARD is part of a larger family of CARD-containing proteins that interact with Bcl10. Other proteins, such as CARMA1 (CARD11), CARMA2 (CARD14), and CARD9, also interact with Bcl10 through CARD-CARD interactions . These interactions are crucial for the assembly of the CBM complex, which plays a central role in lymphocyte activation and NF-κB signaling .

Potential Applications

Understanding the function of BinCARD could provide insights into developing therapeutic strategies for immune-related disorders. By modulating NF-κB signaling, BinCARD could potentially be used to treat conditions characterized by excessive inflammation or immune dysregulation.

Data Tables

While specific data tables for Recombinant Bovine Bcl10-interacting CARD protein are not readily available, the following table summarizes key aspects of BinCARD and related proteins:

ProteinFunctionInteraction
BinCARDInhibits Bcl10-mediated NF-κB activationInteracts with Bcl10 through CARD
Bcl10Activates NF-κB signalingInteracts with CARMA1, MALT1
CARMA1Scaffolds Bcl10 and MALT1Interacts with Bcl10 through CARD
MALT1Activates NF-κB signalingInteracts with Bcl10

References

  1. Inhibition of Bcl10-mediated activation of NF-kappa B by BinCARD: This study identified BinCARD as a novel CARD-containing protein that interacts with Bcl10 to inhibit NF-κB activation .

  2. Molecular Mechanisms of Bcl10-Mediated NF-kappaB Signal: This work discusses the interactions between Bcl10 and various CARD-containing proteins, including BinCARD .

  3. BCL10 – Bridging CARDs to Immune Activation: This article provides an overview of Bcl10's role in immune signaling, including its interactions with CARD-containing proteins .

  4. Structural Insights into the Assembly of CARMA1 and BCL10: This study details the structural basis for the interaction between CARMA1 and Bcl10, highlighting the importance of CARD-CARD interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CARD19; Caspase recruitment domain-containing protein 19; Bcl10-interacting CARD protein; BinCARD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
CARD19
Target Protein Sequence
MTEQTYCDRLVQDTPFLTSLGRLSEQQVDRIILQLNRYYPQILSNKDAEKFRNPKLSLRV RLCDLLGHLQRSGERDCQEFYRALYIHAQPLHSCLPSRHALQNSDCTELDSGNASCELSD RGPVAFLTCLGLAAGLALLIYCCPPDPKVLPGARRVLGFSPVIIDRHVSRFLLAFLTDDL GGL
Uniprot No.

Target Background

Function
Inhibits BCL10-induced NF-κB activation. May inhibit BCL10 phosphorylation in a CARD-dependent manner.
Database Links

KEGG: bta:614217

UniGene: Bt.20062

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is Bovine Bcl10-interacting CARD protein and how does it function?

Bovine Bcl10-interacting CARD protein (such as bovine BinCARD) is a CARD-containing protein that interacts with BCL10 through heterotypic CARD-CARD interactions. This protein contains a caspase recruitment domain (CARD) that mediates protein-protein interactions critical for immune signaling pathways . Functionally, Bcl10-interacting CARD proteins like BinCARD act as negative regulators of BCL10-mediated NF-κB activation by suppressing the phosphorylation of BCL10 .

While human BinCARD has been shown to be ubiquitously expressed across tissues, bovine variants likely follow similar expression patterns with potential tissue-specific differences . The protein serves as an important regulatory component within immune signaling networks where BCL10 acts as a central mediator connecting various CARMA/CARD scaffold proteins to downstream effectors in multiple immune pathways .

What are the structural characteristics of Bcl10-interacting CARD domains?

CARD domains, including those found in Bcl10-interacting proteins, typically consist of a six-helix bundle structure that facilitates specific protein-protein interactions through both electrostatic and hydrophobic contacts. In BinCARD specifically, the CARD domain contains highly conserved leucine residues at positions 17 and 65 that are critical for its functionality . Mutations at these conserved leucine residues (Leu17 or Leu65) abolish the inhibitory effects of BinCARD on BCL10-induced NF-κB activation and phosphorylation .

The structural arrangement of CARD domains in Bcl10-interacting proteins enables specific heterotypic CARD-CARD interactions with BCL10. These interactions involve complementary charged surfaces, where one protein presents a basic CARD surface that engages with the negatively charged surface of its binding partner . This electrostatic complementarity ensures specificity in the assembly of signaling complexes and is likely conserved across species variants including bovine forms.

How is the expression of bovine Bcl10-interacting CARD proteins regulated?

The expression regulation of bovine Bcl10-interacting CARD proteins remains an area requiring further research, but based on known mechanisms for related proteins, regulation likely occurs at multiple levels:

  • Transcriptional regulation: Tissue-specific transcription factors likely control basal expression patterns across different bovine tissues.

  • Post-transcriptional regulation: mRNA stability and alternative splicing may generate tissue-specific isoforms with altered functionality.

  • Post-translational modifications: Like other CARD-containing proteins, bovine Bcl10-interacting CARD proteins are likely subject to phosphorylation, ubiquitination, and other modifications that influence protein stability, localization, and activity .

  • Protein turnover regulation: Degradation pathways including both proteasomal and autophagy-dependent mechanisms may regulate protein levels in response to cellular stimuli, similar to the regulation observed for BCL10 .

In human studies, BinCARD has been found to be ubiquitously expressed , suggesting that bovine variants may also have widespread expression with potential cell-type specific regulation in response to immune stimulation.

What are the optimal expression systems and purification strategies for recombinant bovine Bcl10-interacting CARD protein?

Expression and purification of recombinant bovine Bcl10-interacting CARD protein presents several challenges due to the protein's tendency to form higher-order structures. Based on research with similar CARD-containing proteins, the following methodological approach is recommended:

Expression Systems:

  • Bacterial expression: E. coli BL21(DE3) with pET-based vectors containing an N-terminal His-tag can be used for initial attempts, preferably with reduced induction temperatures (16-18°C) to minimize inclusion body formation.

  • Eukaryotic expression: Insect cell systems (Sf9, High Five) using baculovirus vectors may provide better folding and post-translational modifications compared to bacterial systems.

  • Mammalian expression: HEK293 or CHO cells can be used when authentic mammalian post-translational modifications are required, though with lower yield than bacterial or insect systems.

Purification Strategy:

  • Initial capture using immobilized metal affinity chromatography (IMAC)

  • Ion exchange chromatography to separate charged variants

  • Size exclusion chromatography to isolate monomeric protein and remove aggregates

When purifying CARD-containing proteins, buffer optimization is critical - inclusion of reducing agents (1-5 mM DTT or TCEP) and appropriate salt concentration (typically 150-300 mM NaCl) helps maintain protein solubility and prevent non-specific aggregation of the CARD domain.

What experimental approaches can be used to investigate the interaction between bovine Bcl10 and Bcl10-interacting CARD proteins?

Several complementary approaches can be employed to study the CARD-CARD interactions between bovine BCL10 and its interacting partners:

In vitro interaction studies:

  • Pull-down assays: Using recombinant tagged proteins to assess direct binding between purified components .

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics and affinity constants.

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of the interaction.

Cellular interaction studies:

  • Co-immunoprecipitation: To detect protein-protein interactions in bovine cell lysates under native conditions .

  • Proximity Ligation Assay (PLA): For visualizing interactions in situ within intact cells.

  • Mammalian two-hybrid assay: To verify interactions in a cellular context .

Structural studies:

  • X-ray crystallography: To determine atomic resolution structures of the CARD-CARD complex.

  • Cryo-electron microscopy: Particularly useful for examining larger assemblies and filaments formed by these proteins .

  • NMR spectroscopy: For studying dynamic aspects of the interaction.

Functional validation:

  • Mutagenesis of key residues: Targeted mutations at conserved residues (e.g., Leu17, Leu65) to validate the functional importance of specific amino acids .

  • NF-κB reporter assays: To assess the functional consequence of the interaction on downstream signaling .

How do post-translational modifications regulate the function of bovine Bcl10-interacting CARD proteins?

Post-translational modifications (PTMs) likely play crucial roles in regulating bovine Bcl10-interacting CARD protein function, similar to the extensive regulation documented for BCL10 itself:

Phosphorylation:
Phosphorylation events may regulate:

  • Binding affinity to BCL10

  • Subcellular localization

  • Protein stability and turnover

  • Inhibitory capacity on NF-κB signaling

Based on BCL10 regulation patterns, kinases such as IKKβ, CaMKII, and GSK3β may phosphorylate bovine Bcl10-interacting CARD proteins at serine/threonine residues . Different phosphorylation sites likely have distinct functional outcomes - some enhancing while others diminishing protein activity.

Ubiquitination:
Ubiquitination may regulate:

  • Protein stability and degradation

  • Signaling complex formation

  • Subcellular trafficking

Both K48-linked ubiquitination (leading to proteasomal degradation) and K63-linked ubiquitination (typically involved in signaling complex assembly) may occur on bovine Bcl10-interacting CARD proteins .

Methodological approaches to study PTMs:

  • Mass spectrometry-based proteomics to identify modification sites

  • Phospho-specific antibodies for detecting specific phosphorylation events

  • Site-directed mutagenesis of potential modification sites to assess functional relevance

  • In vitro kinase/ubiquitination assays to identify enzymes responsible for specific modifications

What methods can be used to analyze the inhibitory effect of bovine Bcl10-interacting CARD protein on NF-κB signaling?

To analyze the inhibitory effects of bovine Bcl10-interacting CARD protein on NF-κB signaling, researchers can employ the following methodological approaches:

Cell-based reporter assays:

  • Dual-luciferase NF-κB reporter assay: Transfect bovine cells with NF-κB responsive luciferase reporter along with recombinant bovine Bcl10-interacting CARD protein. Measure luciferase activity following stimulation with NF-κB activators .

  • Dose-response studies: Express increasing amounts of bovine Bcl10-interacting CARD protein to determine the concentration-dependent inhibitory effect.

Biochemical analyses:

  • Western blotting for phosphorylated BCL10: Detect changes in BCL10 phosphorylation states in the presence of recombinant bovine Bcl10-interacting CARD protein .

  • IKK activity assays: Measure the kinase activity of the IKK complex in cell lysates with and without bovine Bcl10-interacting CARD protein expression.

  • Immunoprecipitation of CBM complex components: Assess changes in the assembly of the CARMA/CARD-BCL10-MALT1 complex in the presence of bovine Bcl10-interacting CARD protein.

Functional readouts of NF-κB activity:

  • EMSA (electrophoretic mobility shift assay): To directly measure NF-κB DNA binding activity.

  • ChIP (chromatin immunoprecipitation): To assess NF-κB subunit recruitment to target gene promoters.

  • qRT-PCR and ELISA: To measure expression of NF-κB target genes and secreted cytokines.

What are the experimental challenges in studying filament formation by Bcl10 and its regulation by Bcl10-interacting CARD proteins?

Studying BCL10 filament formation and its regulation by Bcl10-interacting CARD proteins presents several experimental challenges:

Technical challenges in structural biology:

  • Sample preparation for cryo-EM: Obtaining homogeneous preparations of BCL10 filaments with consistent structural properties is challenging due to their dynamic nature .

  • Reconstitution of physiological filaments in vitro: Creating experimental conditions that recapitulate the cellular environment where these filaments naturally form.

  • Resolving heterogeneity: BCL10 filaments may exist in multiple conformational states, complicating structural analysis .

Functional analysis challenges:

  • Real-time monitoring: Developing systems to observe filament dynamics in real-time within living cells.

  • Quantification: Accurately measuring filament formation, elongation rates, and disassembly.

  • Separating effects: Distinguishing between inhibition of filament nucleation versus elongation or stability when studying regulatory factors.

Recommended methodological approaches:

  • Fluorescence microscopy: Using tagged proteins to visualize filament formation in cells .

  • Light scattering techniques: To monitor polymerization kinetics in vitro.

  • Mutagenesis: Strategic mutations at the CARD-CARD interfaces to understand filament assembly mechanisms .

  • In vitro reconstitution: Combining purified components to rebuild minimal systems for filament formation.

  • Super-resolution microscopy: To examine detailed structures below the diffraction limit.

How can recombinant bovine Bcl10-interacting CARD protein be used in comparative immunology studies?

Recombinant bovine Bcl10-interacting CARD protein offers valuable opportunities for comparative immunology research:

Cross-species comparison of immune signaling mechanisms:

  • Comparing the structural and functional conservation of CARD-mediated signaling between bovine, human, and other mammalian systems.

  • Identifying species-specific adaptations in immune signaling cascades that may reflect different pathogen pressures.

  • Evaluating differences in regulatory mechanisms controlling NF-κB activation across species.

Methodological approaches:

  • In vitro signaling reconstitution: Using purified components from different species to compare biochemical properties and interaction specificities.

  • Cross-complementation experiments: Testing whether bovine Bcl10-interacting CARD protein can functionally replace its human ortholog in cellular assays.

  • Structural biology: Comparing the three-dimensional structures of CARD domains across species to identify conserved and divergent features.

  • Evolutionary analysis: Conducting phylogenetic studies to trace the evolutionary history of these signaling components and identify signatures of positive selection.

Potential research applications table:

Research ApplicationMethodological ApproachExpected Outcome
Species-specific immune response patternsEx vivo stimulation of immune cells with comparative analysis of signalingIdentification of unique regulatory mechanisms in bovine immunity
Host-pathogen interaction studiesInfection models using cells expressing bovine vs. human Bcl10-interacting CARD proteinsDiscovery of species-specific vulnerabilities or resistance mechanisms
Agricultural immunologyDevelopment of bovine-specific immune modulatorsPotential therapeutic approaches for cattle diseases
Evolutionary immunologySequence and structural comparison across multiple speciesUnderstanding of evolutionary pressures shaping immune signaling

What are the promising future research directions for bovine Bcl10-interacting CARD proteins?

Several promising research directions could advance our understanding of bovine Bcl10-interacting CARD proteins:

Structural characterization:

  • High-resolution structures of bovine Bcl10-interacting CARD proteins alone and in complex with BCL10.

  • Comparative structural analysis with human orthologs to identify species-specific features.

  • Cryo-EM studies of higher-order assemblies formed by these proteins.

Functional characterization in bovine-specific immune contexts:

  • Role in bovine-specific immune responses to relevant pathogens.

  • Tissue-specific expression patterns and functions in specialized bovine immune compartments.

  • Species-specific signaling pathways and binding partners.

Therapeutic potential:

  • Exploitation of the inhibitory effect on NF-κB signaling for therapeutic applications in bovine inflammatory diseases.

  • Development of peptide inhibitors based on CARD-CARD interaction interfaces.

  • Investigation of bovine Bcl10-interacting CARD proteins as potential targets for veterinary medicine.

Systems biology approaches:

  • Integration of bovine Bcl10-interacting CARD proteins into comprehensive models of immune signaling networks.

  • Comparative systems analysis of CBM complex regulation across species.

  • Computational prediction of species-specific regulatory mechanisms.

Research challenges to address:

  • Limited availability of bovine-specific research tools and reagents.

  • Complexity of studying protein-protein interactions in physiologically relevant contexts.

  • Translating in vitro findings to in vivo significance in bovine immunity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.