Recombinant Bovine BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (BNIP3L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its inclusion in the production process.
Synonyms
BNIP3L; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MSSHLVEQPPPPHNNNNNCEEGEQSLPPPAGLNSSWVELPMNSSNGNDNGNGKNGGLEHV PSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSKDHSSQS EEEVAEGEKEVDALKKSVDWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGI FSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY
Uniprot No.

Target Background

Function

Recombinant Bovine BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (BNIP3L) induces apoptosis and interacts with viral and cellular anti-apoptosis proteins. While it can overcome the inhibitory effects of BCL-2 and BCL-XL, high BCL-XL expression may impede apoptosis. It also inhibits BNIP3-induced apoptosis. Furthermore, BNIP3L plays a role in mitochondrial quality control through interaction with SPATA18/MIEAP. In response to mitochondrial damage, it participates in the mitochondrial protein catabolic process (MALM), degrading damaged mitochondrial proteins. The interaction of SPATA18/MIEAP, BNIP3, and BNIP3L/NIX at the mitochondrial outer membrane regulates pore formation in the mitochondrial double membrane, facilitating the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. BNIP3L may function as a tumor suppressor.

Database Links

KEGG: bta:534615

STRING: 9913.ENSBTAP00000033770

UniGene: Bt.888

Protein Families
NIP3 family
Subcellular Location
Nucleus envelope. Endoplasmic reticulum. Mitochondrion outer membrane. Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of BNIP3L and how does it compare between bovine and human forms?

BNIP3L (also known as NIX) is a mitochondrial outer membrane protein containing a single BH3 domain that belongs to the BCL2 family. The protein typically appears in two forms on polyacrylamide gels: as a monomer (~42 kDa) and as a stable, dominant dimer (~80 kDa). The bovine BNIP3L shares significant homology with human BNIP3L.

Key structural elements include:

  • A transmembrane domain at the C-terminus that anchors it to mitochondrial and ER membranes

  • A conserved LC3-interacting region (LIR) motif at the N-terminus that mediates binding to LC3/GABARAP proteins

  • Phosphorylation sites near the LIR motif (Ser34 and Ser35) that enhance mitophagy receptor engagement

  • Ser212 in the intramembrane C-terminal region that regulates dimerization when dephosphorylated

For experimental work, recombinant bovine BNIP3L is available in multiple expression systems including:

Expression SystemCharacteristicsApplications
E. coliTag-free, high yieldBinding studies, structural analysis
YeastBetter folding, some PTMsFunctional studies
BaculovirusMore native-like PTMsAdvanced functional studies
Mammalian cellMost native-like structureCell-based assays, complex interactions

Researchers should select the appropriate expression system based on their specific experimental requirements and whether post-translational modifications are essential for their studies .

What are the primary cellular functions of BNIP3L and how do they differ across tissue types?

BNIP3L serves dual functions in cells, balancing between programmed cell death (apoptosis) and selective autophagy (mitophagy):

  • Mitophagy regulation: BNIP3L acts as a receptor that mediates selective removal of mitochondria by:

    • Binding to LC3/GABARAP proteins via its LIR domain

    • Recruiting autophagosomes to mitochondria

    • Facilitating clearance of mitochondria during cellular development and in response to stress

  • Apoptosis induction: Originally characterized as a pro-apoptotic protein that:

    • Interacts with anti-apoptotic proteins BCL-2 and BCL-XL

    • Can overcome suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis

    • Contains a BH3 domain, though it functions differently from typical BH3-only proteins

Tissue-specific functions include:

Tissue/Cell TypePrimary BNIP3L FunctionSignificance
ErythrocytesProgrammed mitochondrial clearance during terminal differentiationEssential for proper red blood cell maturation
CardiomyocytesMitochondrial quality controlCrucial for maintenance of cardiac function; dysregulation leads to heart failure
Hippocampal neuronsMitophagy-mediated protection from stressPrevents synaptic dysfunction from damaged mitochondria
Intestinal epitheliumReduction of mitochondrial stressProtects against intestinal inflammation
Skeletal muscleMitochondrial breakdown signalingAssociated with severity in chronic obstructive pulmonary disease
Lens fiber cellsClearance of mitochondria, ER and GolgiRequired for proper lens development
Hair folliclesMitophagy to eliminate "living" characteristicsCompletes transition from living to dead cells
Retinal ganglion cellsHIF1A-induced mitophagyMetabolic shift toward glycolysis essential for neurogenesis

This tissue-specific expression and function must be considered when designing experiments targeting BNIP3L in different cellular contexts .

What are the optimal approaches for validating BNIP3L-mediated mitophagy in experimental settings?

To effectively validate BNIP3L-mediated mitophagy, researchers should employ multiple complementary techniques that assess different aspects of the process:

1. Protein expression and localization:

  • Western blotting to detect BNIP3L (both monomeric ~42kDa and dimeric ~80kDa forms)

  • Immunofluorescence microscopy to visualize BNIP3L colocalization with mitochondria and autophagosomes

  • Subcellular fractionation to confirm mitochondrial localization

2. Mitophagy detection methods:

  • Mitophagy reporter systems:

    • mt-Keima: pH-sensitive fluorescent protein targeted to mitochondria that changes spectral properties when mitochondria enter lysosomes

    • mito-QC: tandem GFP-mCherry reporter where GFP is quenched in acidic lysosomes while mCherry remains stable

    • FIS1-GFP-mCherry: Similar principle as mito-QC but using the mitochondrial fission protein FIS1 as an anchor

  • Mitochondrial mass assessment:

    • Flow cytometry with MitoTracker dyes

    • Immunoblotting for mitochondrial markers (TOM20, COX IV, VDAC)

    • Electron microscopy to visualize mitochondrial clearance

    • Citrate synthase activity assay

3. Functional validation:

  • BNIP3L gene silencing (siRNA) or knockout (CRISPR/Cas9) to demonstrate specificity

  • Rescue experiments with wild-type and mutant BNIP3L constructs

  • Inhibition of autophagy (Bafilomycin A1, chloroquine) to confirm autophagy dependence

  • Mitochondrial function assays (oxygen consumption, membrane potential)

Recommended experimental controls:

  • Use of both gain-of-function (overexpression) and loss-of-function (knockdown/knockout) approaches

  • Include PINK1/Parkin pathway manipulation as comparison to receptor-mediated mitophagy

  • Test BNIP3L LIR mutants and dimerization mutants to verify mechanistic details

  • Include BNIP3 manipulations to account for potential compensatory effects

A comprehensive approach combining these methods provides robust validation of BNIP3L-mediated mitophagy, reducing the risk of experimental artifacts from any single technique .

How can researchers effectively distinguish between BNIP3L-mediated mitophagy and other forms of mitochondrial quality control?

Distinguishing BNIP3L-mediated mitophagy from other forms of mitochondrial quality control requires careful experimental design that isolates the specific pathway:

Comparison of mitophagy pathways:

PathwayKey ProteinsTriggerCharacteristics
BNIP3L/NIXBNIP3L, LC3/GABARAPDevelopmental signals, hypoxiaLIR-dependent, receptor-mediated
PINK1/ParkinPINK1, Parkin, ubiquitinMitochondrial damage, depolarizationUbiquitin-dependent, damage-induced
FUNDC1FUNDC1, LC3HypoxiaRegulated by phosphorylation status
BNIP3BNIP3, LC3/GABARAPHypoxia, metabolic stressSimilar to BNIP3L but different expression pattern
PHB2Prohibitin 2, LC3Inner membrane exposureActs after outer membrane rupture

Methodological approaches to distinguish pathways:

  • Genetic isolation:

    • Use cells from BNIP3L knockout models while maintaining other mitophagy pathways

    • Employ BNIP3L-specific siRNA while confirming no effect on PINK1/Parkin components

    • Use ATG7-KO cells to distinguish macroautophagy-dependent mitophagy from other processes

  • Pathway-specific induction:

    • BNIP3L: Induce with hypoxia or HIF1α stabilizers like CoCl₂

    • PINK1/Parkin: Use mitochondrial uncouplers (CCCP, FCCP)

    • Combined approach: Use BNIP3L inducers in PINK1/Parkin-deficient cells

  • Molecular distinction:

    • Monitor BNIP3L phosphorylation status (Ser34/35 and Ser212)

    • Assess dimerization status of BNIP3L

    • Examine ubiquitination patterns (predominant in PINK1/Parkin pathway)

    • Use LIR mutant forms of BNIP3L that cannot interact with LC3/GABARAP

  • Temporal analysis:

    • BNIP3L pathway is often active during developmental processes

    • PINK1/Parkin responds rapidly to acute damage

    • Sequential monitoring can distinguish these temporal patterns

  • Physiological context:

    • Study BNIP3L in relevant physiological contexts (e.g., erythrocyte differentiation)

    • Examine clearance of healthy vs. damaged mitochondria

    • Combine with other cellular stress responses like ER stress

For example, a study demonstrated that BNIP3L depletion in FBXL4-KO cells still markedly upregulated BNIP3/BNIP3L protein levels even in ATG7-KO cells where macroautophagy is blocked, indicating that the impact of FBXL4 on BNIP3L is independent of macroautophagy . This type of mechanistic separation is essential for correctly attributing mitophagy effects to specific pathways .

How is BNIP3L activity regulated at the molecular level and what methods are available to study these regulatory mechanisms?

BNIP3L activity is regulated through multiple molecular mechanisms that control its expression, stability, localization, and functional activity:

1. Transcriptional regulation:

  • HIF1α-dependent upregulation during hypoxia

  • Developmental programming during erythropoiesis and other differentiation processes

Methods to study:

  • qRT-PCR for mRNA expression analysis

  • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding

  • Reporter gene assays with BNIP3L promoter constructs

  • RNA-seq to assess global transcriptional changes

2. Post-translational modifications:

  • Phosphorylation of Ser34/35 near the LIR motif enhances LC3/GABARAP binding

  • Dephosphorylation of Ser212 in the C-terminal region controls dimerization

  • Ubiquitination targeting by FBXL4 as part of CRL1 ubiquitin ligase complex

Methods to study:

  • Phospho-specific antibodies for Western blotting

  • Mass spectrometry to identify modification sites

  • Mutagenesis studies (phospho-mimetic and phospho-dead mutants)

  • In vitro kinase and phosphatase assays

  • Proteasomal inhibition experiments with MG132

  • Protein half-life determination with cycloheximide chase assays

3. Protein-protein interactions:

  • Dimerization/oligomerization of BNIP3L

  • Binding to LC3/GABARAP proteins

  • Interactions with BCL-2 family members

  • FBXL4 binding for degradation control

Methods to study:

  • Co-immunoprecipitation assays

  • Yeast two-hybrid screening

  • Proximity ligation assays

  • FRET/BRET interaction analysis

  • Surface plasmon resonance for binding kinetics

  • Crosslinking studies for complex formation

4. Subcellular localization:

  • Mitochondrial outer membrane insertion

  • ER membrane localization

  • Golgi apparatus localization

Methods to study:

  • Subcellular fractionation

  • Immunofluorescence microscopy

  • Electron microscopy with immunogold labeling

  • APEX2 proximity labeling to identify neighboring proteins

  • Live-cell imaging with fluorescently-tagged BNIP3L

An integrated approach combining these methods provides comprehensive understanding of BNIP3L regulation. For example, researchers discovered that FBXL4 directly interacts with BNIP3L, promoting its degradation through the ubiquitin-proteasome pathway. This was demonstrated through a series of experiments showing that wild-type FBXL4 reduced BNIP3L protein levels in a dose-dependent manner, while the ΔF-BOX mutant had no effect, and proteasome inhibitor MG132 reversed FBXL4's effect on BNIP3L levels .

What are the key interaction partners of BNIP3L and how do these interactions influence its dual roles in mitophagy and apoptosis?

BNIP3L engages with multiple protein partners that influence its functions in mitophagy and apoptosis. Understanding these interactions is crucial for dissecting the molecular mechanisms governing BNIP3L's dual roles:

Key interaction partners and functional consequences:

Interaction PartnerBinding RegionFunctional OutcomeResearch Techniques
LC3/GABARAP proteinsN-terminal LIR motifAutophagosome recruitment, mitophagy promotionGST pulldown, co-IP, peptide arrays, structural studies
BCL-2, BCL-XLBH3 domainInhibition of anti-apoptotic activity, apoptosis regulationCo-IP, fluorescence polarization, yeast two-hybrid
BNIP3Transmembrane domainHeterodimer formation, modulation of activityCo-IP, FRET, crosslinking studies
FBXL4 (CRL1 complex)Unknown (targeted region)Ubiquitination and proteasomal degradationCo-IP, ubiquitination assays, degradation kinetics
SPATA18/MIEAPUnknownMitochondrial quality controlCo-IP, microscopy for colocalization
PINK1/Parkin componentsUnknownPotential crosstalk with damage-induced mitophagyCo-IP, functional assays in knockout models

Regulatory mechanisms governing the switch between mitophagy and apoptosis:

  • Phosphorylation-dependent regulation:

    • Phosphorylation of Ser34/35 enhances LC3 binding and mitophagy

    • The phosphorylation status likely influences the balance between mitophagy and apoptosis

  • Dimerization and oligomerization:

    • BNIP3L dimerization is essential for both mitophagy and potentially apoptotic functions

    • Dephosphorylation of Ser212 regulates dimerization

    • BNIP3L dimers bind LC3 more strongly and recruit autophagosomes more robustly

  • Expression level thresholds:

    • Low levels of BNIP3L may preferentially promote mitophagy

    • High expression levels might trigger apoptotic pathways

    • BCL-XL levels can counter BNIP3L-induced apoptosis

  • Subcellular localization:

    • Mitochondrial localization facilitates both mitophagy and apoptosis

    • ER localization may influence calcium homeostasis and apoptotic signaling

    • Dual localization potentially allows compartment-specific functions

  • Cell-type specific factors:

    • In erythrocytes, BNIP3L predominantly mediates mitophagy

    • In cardiomyocytes under stress, both mitophagy and apoptotic functions are observed

Research has shown that disruption of dimerization, by mutations in the transmembrane domain, causes similar effects on mitophagy as LIR disruption, highlighting the importance of BNIP3L's structural integrity for its function. Additionally, studies demonstrated that BNIP3L was degraded by the proteasome in ischemic neurons and brains, inducing mitophagy deficiency, but this deficiency could be rescued if dimerized BNIP3L was added or proteasomal degradation was blocked .

How does BNIP3L dysfunction contribute to disease pathology, and what experimental models best capture these pathological processes?

BNIP3L dysfunction has been implicated in multiple disease states through either excessive activation or insufficient function:

Pathological involvement of BNIP3L in diseases:

Disease ContextBNIP3L DysfunctionPathological ConsequenceExperimental Models
Heart failureUpregulationCardiomyocyte dropout after chronic pressure overloadCardiac-specific BNIP3L transgenic mice; pressure overload models (TAC)
Cerebral ischemiaProteasomal degradationMitophagy deficiency, increased injuryMCAO stroke models; oxygen-glucose deprivation in neurons
Muscular disordersAltered expressionMuscle atrophy, metabolic dysfunctionMuscle-specific knockout mice; bnip3l-KO with ragged-red fiber phenotype
Mitochondrial myopathiesInsufficient mitophagyAccumulation of dysfunctional mitochondriaPatient-derived fibroblasts; GWAS-identified variants
CancerContext-dependentTumor suppression or promotion depending on cancer typeCancer cell lines; xenograft models; patient samples
Neurodegenerative disordersDysregulated mitophagySynaptic dysfunction, neuronal deathPrimary hippocampal neurons; transgenic models
Intestinal inflammationReduced functionAccumulation of dysfunctional mitochondriaIntestinal epithelial cell models; colitis models
COPDIncreased mitochondrial breakdownSkeletal muscle dysfunction, disease severityMuscle biopsies; cigarette smoke exposure models
Mitochondrial DNA depletionFBXL4 mutations causing BNIP3L accumulationExcessive mitophagy, mtDNA depletionFBXL4-KO cells; patient-derived cells with MTDPS13

Experimental approaches for studying BNIP3L in disease contexts:

  • Genetic models:

    • Muscle-specific BNIP3L knockout mice show ragged-red fiber phenotype, mitochondrial accumulation, and altered metabolism with increased insulin sensitivity

    • Cardiac-specific transgenic overexpression models demonstrate heart failure development

    • CRISPR/Cas9-generated knockout cell lines for in vitro studies

  • Disease-mimicking conditions:

    • Hypoxia chambers to simulate ischemic conditions

    • CoCl₂ treatment to stabilize HIF1α and induce BNIP3L expression

    • Metabolic stress induction (nutrient deprivation, high glucose)

  • Patient-derived materials:

    • Fibroblasts, iPSCs, or tissue samples from patients with mitochondrial disorders

    • Cancer tissue microarrays for expression profiling

    • GWAS-identified BNIP3L variants for functional characterization

  • Infection models:

    • B. abortus infection model shows BNIP3L-dependent mitophagy promotes bacterial exit

    • BNIP3L depletion via siRNA reduces reinfection events

  • Drug intervention studies:

    • Proteasome inhibitors to prevent BNIP3L degradation in ischemic models

    • Manipulation of BNIP3L dimerization as therapeutic strategy

Recent research has highlighted that BNIP3L-mediated mitophagy is crucial in various tissues. For example, in hippocampal neurons, stress-induced glucocorticoids cause BNIP3L reduction, leading to accumulation of damaged mitochondria, reduced mitochondrial respiration, and decreased synaptic density. Additionally, muscle-specific knockout models reveal that BNIP3L is necessary for maintaining proper muscle phenotype through coordinated mitophagy, reticulophagy, and regulation of nuclear calcium signaling .

What are the emerging therapeutic strategies targeting BNIP3L, and how can researchers evaluate their efficacy in preclinical models?

Several promising therapeutic strategies targeting BNIP3L are emerging in preclinical research, each requiring specific approaches for efficacy evaluation:

Therapeutic strategies targeting BNIP3L:

Therapeutic ApproachMechanismTarget DiseasesEvaluation Methods
BNIP3L stabilizationPrevention of proteasomal degradationCerebral ischemia, neurodegenerative diseasesNeuroprotection assays, behavioral testing, tissue damage assessment
Dimerization enhancementPromoting BNIP3L dimers to enhance mitophagyMitochondrial myopathies, ischemic injuryMitophagy flux measurement, mitochondrial function assays
Phosphorylation modulationTargeting kinases/phosphatases regulating BNIP3LContext-dependent applicationsPhosphorylation-specific antibodies, functional readouts
BNIP3L mimeticsPeptides mimicking LIR domain or key functional regionsMitochondrial dysfunction disordersMitophagy induction, mitochondrial clearance assessment
Inhibition of BNIP3L-mediated mitophagyBlocking excessive mitophagyBacterial infections, MTDPS13Infection models, mtDNA quantification
Selective induction of mitophagy vs. apoptosisManipulating BNIP3L to favor mitophagy over cell deathHeart failure, neurodegenerationCell survival assays, tissue function assessment

Preclinical evaluation approaches:

  • In vitro efficacy assessment:

    • Cell-based high-throughput screening platforms

    • Mitophagy reporter systems (mt-Keima, mito-QC) to quantify mitophagy flux

    • Mitochondrial function assays (Seahorse XF, membrane potential)

    • Cell viability and apoptosis assays to distinguish protective vs. harmful effects

    • Time-lapse imaging to monitor dynamics of mitophagy and cell fate

  • Ex vivo systems:

    • Organotypic slice cultures (brain, heart)

    • Primary cell cultures from disease models

    • Patient-derived organoids for personalized medicine approaches

  • In vivo efficacy evaluation:

    • Disease-relevant animal models (e.g., stroke, heart failure, mitochondrial disease)

    • Tissue-specific conditional BNIP3L models for targeted intervention

    • Non-invasive imaging of mitochondrial function and clearance

    • Functional assessments (e.g., cardiac function, neurobehavioral testing)

    • Molecular and biochemical analysis of target engagement

  • Target validation approaches:

    • CRISPR-mediated knock-in of specific BNIP3L mutations to validate mechanisms

    • Genetic rescue experiments in knockout models

    • Pathway-specific inhibitors to validate mechanism of action

    • Pharmacokinetic and pharmacodynamic studies

  • Translational considerations:

    • Biomarker development for patient stratification

    • Genetic screening to identify patients most likely to benefit

    • Combination therapy approaches (e.g., with existing mitochondrial medicines)

Recent research has demonstrated that BNIP3L could be a potential therapeutic target for ischemic stroke. For instance, studies showed that cerebral ischemic injury could be prevented if dimerized BNIP3L was added or if proteasomal degradation of BNIP3L was blocked. This suggests that BNIP3L dimerization and mitophagy reactivation represent an excellent therapeutic strategy for neuronal recovery after cerebral ischemic injury. Additionally, in the context of infectious diseases, BNIP3L depletion drastically reduced bacterial reinfection events, suggesting that inhibition of BNIP3L-mediated mitophagy might be beneficial in certain infection contexts .

What are the methodological challenges in studying the dual localization of BNIP3L at mitochondria and endoplasmic reticulum, and how can these be addressed?

Studying the dual localization of BNIP3L presents several methodological challenges that require specialized approaches:

Challenges and methodological solutions:

ChallengeTechnical LimitationAdvanced Solutions
Simultaneous visualization of multiple organellesSpectral overlap, resolution limitsSuper-resolution microscopy (STORM, STED); correlative light and electron microscopy (CLEM)
Quantifying organelle-specific poolsFractionation cross-contaminationProximity labeling approaches (APEX2, BioID); organelle-specific biotinylation
Determining functional significance of each poolInability to selectively target one poolOrganelle-targeted BNIP3L constructs with modified targeting sequences
Capturing dynamic relocalizationTemporal resolution limitationsLive-cell imaging with photoactivatable fluorescent tags; pulse-chase approaches
Distinguishing direct vs. indirect effectsPleiotropic effects of BNIP3L manipulationAcute and inducible targeting systems (optogenetics, chemogenetics)
Organelle contact site analysisLimited tools for contact site biologySplit fluorescent protein systems; in situ proximity ligation assays

Innovative experimental approaches:

  • Advanced imaging strategies:

    • Lattice light-sheet microscopy for 4D imaging with reduced phototoxicity

    • Expansion microscopy combined with multi-color imaging

    • FRET/FLIM-based sensors to detect conformational changes in different compartments

    • FIB-SEM (Focused Ion Beam-Scanning Electron Microscopy) for 3D ultrastructural analysis

  • Biochemical separation techniques:

    • Sequential density gradient fractionation optimized for mitochondria-ER contact sites

    • Immuno-isolation of specific membrane domains using magnetic beads

    • Protease protection assays to map topology in different membranes

    • Chemical crosslinking followed by mass spectrometry to identify interaction partners

  • Genetic engineering approaches:

    • CRISPR knock-in of compartment-specific tags on endogenous BNIP3L

    • Split-protein complementation assays to monitor associations

    • Organelle-specific BNIP3L tethering systems to distinguish functions

    • Synthetic biology approaches to rewire BNIP3L localization

  • Functional assessment strategies:

    • Calcium flux measurements at ER-mitochondria contact sites

    • Compartment-specific phosphorylation state analysis

    • Local ubiquitination dynamics in different organelles

    • Selective mitophagy vs. reticulophagy quantification

Recent research has demonstrated that BNIP3L localizes to both mitochondria and ER/Golgi membranes. For example, studies showed that BNIP3L localizes to the endoplasmic reticulum and Golgi apparatus of wild-type newborn mouse lenses and is contained within mitochondria, endoplasmic reticulum, and Golgi apparatus isolated from adult mouse liver. Furthermore, deletion of BNIP3L not only impacts mitochondrial clearance but also results in retention of endoplasmic reticulum and Golgi apparatus, suggesting broader roles in organelle homeostasis that require sophisticated methodologies to fully characterize .

How do BNIP3L and BNIP3 coordinate their functions, and what experimental approaches can distinguish their specific roles in various cellular contexts?

BNIP3L (NIX) and BNIP3 are related mitophagy receptors with overlapping yet distinct functions. Understanding their coordination and specific roles requires sophisticated experimental approaches:

Comparative analysis of BNIP3L and BNIP3:

FeatureBNIP3L/NIXBNIP3Experimental Approaches
Expression patternErythroid cells, heart, brain, muscle, lensHeart, brain, lung, muscleCell-type specific qPCR; tissue microarrays; single-cell RNA-seq
Subcellular localizationMitochondria, ER, GolgiPrimarily mitochondriaSubcellular fractionation; immunofluorescence with specific antibodies
Induction signalsDevelopmental, hypoxia, metabolic stressPrimarily hypoxiaPromoter analysis; transcription factor ChIP; hypoxia time course
Primary physiological rolesProgrammed mitophagy in erythropoiesisStress-induced mitophagyLineage-specific knockout models; developmental analyses
Autophagy interactionsLC3/GABARAP binding via LIRLC3/GABARAP binding via LIRComparative binding assays; structural studies
Apoptotic potentialWeaker pro-apoptotic effectStronger pro-apoptotic effectApoptosis assays with individual overexpression

Experimental strategies to dissect specific functions:

  • Genetic manipulation approaches:

    • Single and double knockout models to identify unique and redundant functions

    • Protein domain swap experiments between BNIP3 and BNIP3L

    • Rescue experiments with chimeric proteins

    • CRISPR activation/interference for selective expression modulation

  • Biochemical and structural studies:

    • Comparative binding affinity measurements for shared partners

    • Structural analysis of dimerization interfaces

    • Phosphorylation mapping with phospho-specific antibodies

    • Ubiquitination and degradation kinetics comparison

  • Temporal and spatial regulation:

    • Tissue-specific inducible expression systems

    • Developmental time course studies

    • Stress-response kinetics comparison

    • Single-cell analysis techniques to capture heterogeneity

  • Functional compensation assessment:

    • mRNA and protein expression changes in single knockouts

    • Identification of compensatory pathways

    • Acute vs. chronic depletion effects

    • Synthetic lethality screening

  • Disease model applications:

    • Comparative roles in disease-specific contexts

    • Selective targeting approaches for therapeutic development

    • Biomarker studies to identify context-specific activation

Recent research has demonstrated that BNIP3 and BNIP3L can have both unique and overlapping functions. For example, in the DFP-induced pexophagy model, silencing of not only NIX (BNIP3L) but also BNIP3 impaired pexophagy. Furthermore, silencing these two proteins together completely abolished DFP-induced pexophagy, suggesting they share similar functions in the pexophagy pathway. This indicates that while BNIP3L may play the primary role in specific contexts, BNIP3 can also contribute to the same processes, and their relative importance may vary depending on cell type or signaling conditions .

How do different expression systems for recombinant BNIP3L affect protein functionality, and what quality control metrics should researchers implement?

The choice of expression system for recombinant BNIP3L significantly impacts protein functionality, with important considerations for research applications:

Comparison of expression systems for recombinant BNIP3L:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield; cost-effective; simple purificationLimited PTMs; potential improper folding; inclusion body formationStructural studies; antibody production; interaction domains
YeastBetter protein folding; some PTMs; higher yield than mammalianGlycosylation patterns differ from mammalian; limited complex PTMsFunctional studies requiring basic PTMs; large-scale production
BaculovirusMore mammalian-like PTMs; good for membrane proteins; moderate yieldMore complex system; longer production time; higher costFunctional studies; enzymatic assays; structural biology
Mammalian cellMost native-like PTMs and folding; proper membrane integrationLowest yield; highest cost; technical complexityCell-based assays; studies of physiologically relevant interactions
In vitro translationRapid production; minimal systemLimited scale; variable quality; expensiveQuick testing; prototype evaluation; labeled protein production

Critical quality control metrics for recombinant BNIP3L:

  • Purity assessment:

    • SDS-PAGE (reducing and non-reducing conditions) to verify molecular weight (typically shows ~36 kDa under reducing conditions)

    • Size exclusion chromatography to assess aggregation state

    • Mass spectrometry for precise mass determination and integrity verification

  • Structural integrity validation:

    • Circular dichroism to assess secondary structure

    • Thermal shift assays to evaluate stability

    • Limited proteolysis to confirm domain folding

    • Native PAGE to assess oligomeric state (monomer/dimer ratio)

  • Functional validation:

    • LC3/GABARAP binding assays (e.g., pulldown experiments, SPR, MST)

    • Dimerization assessment under various conditions

    • Membrane integration capacity (for full-length constructs)

    • Phosphorylation status at key regulatory sites (Ser34/35, Ser212)

  • Post-translational modification analysis:

    • Phosphorylation site mapping by mass spectrometry

    • Western blotting with phospho-specific antibodies

    • Other PTM detection (ubiquitination, acetylation) if relevant

  • Batch-to-batch consistency checks:

    • Standardized functional assays for activity comparison

    • Storage stability monitoring

    • Freeze-thaw tolerance testing

    • Lot-specific validation with application-relevant assays

Optimization strategies for specific applications:

  • For structural studies: Consider tag-free E. coli expression with optimization for solubility or controlled refolding

  • For interaction studies: Tag position optimization to avoid interference with binding sites

  • For cell-based assays: Mammalian expression with verified trafficking to correct organelles

  • For in vivo studies: Careful endotoxin removal and biocompatibility testing

According to product information, recombinant human BNIP3L protein expressed in E. coli typically shows a molecular weight of 36 kDa under reducing conditions despite a predicted mass of 20.4 kDa, likely due to the highly structured nature of the protein. Purity metrics should exceed 88% as determined by SDS-PAGE, and proper formulation (typically in buffers containing 50 mM Tris, 150 mM NaCl, 1 mM DTT, pH 8.0 with protective agents) is crucial for maintaining stability .

What are the optimal conditions for using recombinant BNIP3L in functional mitophagy assays, and how can results be standardized across different experimental systems?

Optimizing recombinant BNIP3L use in functional mitophagy assays requires careful attention to experimental conditions and standardization approaches:

Optimal conditions for recombinant BNIP3L in functional assays:

Assay TypeRecommended ConditionsCritical ParametersValidation Approaches
Cell-free binding assays4°C or 25°C; pH 7.0-7.5; 150mM NaCl; 0.5-1% detergentProtein concentration; buffer composition; incubation timeGST-LC3 pulldown; AlphaScreen; microscale thermophoresis
Cell-based deliveryCationic lipid transfection; protein transduction domains; nanoparticle encapsulationDelivery efficiency; cytotoxicity; subcellular targetingFluorescently labeled protein tracking; functional readouts
Membrane integration studiesLiposome reconstitution; nanodiscs; semi-permeabilized cellsLipid composition; protein:lipid ratio; orientationProtease protection assays; FRET-based insertion monitoring
Mitophagy induction assays1-10 μg/ml protein; serum-free conditions initially; 2-24 hour monitoringCell type; confluency; metabolic state; monitoring timelineMitochondrial mass quantification; autophagosome colocalization
Phosphorylation studiesIn vitro kinase reactions: ATP, Mg²⁺, kinase source, 30°CPhosphorylation sites targeted; kinase selection; reaction timePhospho-specific antibodies; ³²P incorporation; mass spectrometry

Standardization approaches for cross-laboratory comparison:

  • Reference standards and controls:

    • Establish common positive controls (e.g., CCCP for PINK1/Parkin pathway)

    • Include standardized negative controls (e.g., LIR-mutant BNIP3L)

    • Develop quantifiable reference standards for dose-response calibration

    • Use internal normalization controls for cell-based assays

  • Protocol standardization:

    • Detailed step-by-step SOPs with critical parameter specifications

    • Time-course standardization for dynamic processes

    • Consistent cell lines, passage numbers, and culture conditions

    • Standardized buffer compositions and reagent specifications

  • Measurement and analysis standardization:

    • Consensus quantification methods for mitophagy flux

    • Standard data normalization approaches

    • Open-source analysis software and algorithms

    • Shared positive/negative thresholds for binary classifications

  • Reporting standards:

    • Minimum information requirements for mitophagy assays

    • Complete methodological transparency

    • Raw data sharing and accessibility

    • Detailed protein characterization metrics

  • Cross-validation approaches:

    • Multiple complementary assays to confirm findings

    • Orthogonal techniques for key measurements

    • Cell-free to cell-based validation pipeline

    • In vitro to in vivo translation validation

Practical implementation example:

For a standardized mitophagy induction assay using recombinant BNIP3L:

  • Protein preparation:

    • Verify dimer/monomer ratio by non-reducing SDS-PAGE (optimal ~70% dimer)

    • Confirm LC3-binding activity via pull-down assay

    • Determine phosphorylation status at Ser34/35 and Ser212

    • Store in single-use aliquots with minimal freeze-thaw cycles

  • Cell preparation:

    • Use defined cell lines at 70-80% confluency

    • Standardize culture conditions (medium composition, serum %)

    • Include both mitophagy-competent (e.g., HeLa) and specialized (e.g., differentiated C2C12) cells

    • Pre-establish baseline mitochondrial metrics

  • Assay procedure:

    • Protein delivery via optimized lipid transfection (protein:lipid ratio 1:3)

    • Include BNIP3L-LIR mutant and wild-type controls

    • Monitor at standardized time points (2h, 6h, 12h, 24h)

    • Measure multiple parameters: mitochondrial mass, mitophagy flux, cell viability

  • Data analysis:

    • Normalize to internal controls

    • Apply standardized gating for flow cytometry

    • Use consensus image analysis algorithms

    • Report both absolute and relative changes

By implementing these standardized approaches, researchers can ensure that functional studies of recombinant BNIP3L produce comparable and reproducible results across different laboratories and experimental systems .

What novel roles for BNIP3L beyond mitophagy and apoptosis are emerging, and what experimental strategies are needed to explore these functions?

Recent research has uncovered several novel roles for BNIP3L beyond its canonical functions in mitophagy and apoptosis:

Emerging non-canonical functions of BNIP3L:

Novel FunctionCellular ContextSupporting EvidenceResearch Implications
Pexophagy (peroxisome autophagy)Multiple cell typesBNIP3L localizes to peroxisomes; pexophagy impaired in BNIP3L-depleted cellsConnects BNIP3L to broader organelle quality control
Reticulophagy (ER autophagy)Lens fiber cells, other tissuesBNIP3L knockout leads to ER retention; BNIP3L localizes to ERSuggests role in coordinated multi-organelle clearance
Nuclear calcium signaling regulationMuscle cellsMuscle-specific knockout alters NFAT signaling; changes in muscle fiber-typeLinks BNIP3L to transcriptional regulation pathways
Insulin sensitivity modulationSkeletal muscleBNIP3L knockout mice show increased insulin sensitivity; more glycogen-rich fibersConnects mitochondrial quality to metabolic regulation
Bacterial infection cycle regulationInfected host cellsBNIP3L depletion reduces bacterial reinfection eventsReveals role in host-pathogen interactions
Development/differentiation programsHair follicles, lens, erythrocytesDevelopmental expression patterns; differentiation defects in knockoutsPositions BNIP3L as developmental regulator
Golgi apparatus homeostasisMultiple tissuesBNIP3L localizes to Golgi; Golgi retention in knockout modelsExpands role to additional organelles

Advanced experimental strategies to explore novel functions:

  • Organelle-specific targeting and analysis:

    • Peroxisome-targeted BNIP3L constructs

    • Fluorescent reporter systems for multiple organelles (mito-ER-lyso-peroxisome quadruple imaging)

    • Organelle-specific isolation techniques followed by proteomic analysis

    • CLEM (Correlative Light and Electron Microscopy) for ultrastructural context

  • Signaling pathway investigations:

    • Phosphoproteomics to identify altered signaling networks

    • Calcium imaging with targeted sensors

    • Nuclear translocation assays for transcription factors

    • Chromatin immunoprecipitation to identify regulated genes

  • Developmental biology approaches:

    • Tissue-specific and temporal conditional knockouts

    • Lineage tracing in BNIP3L reporter models

    • Single-cell transcriptomics during differentiation processes

    • In vivo imaging of developmental dynamics

  • Metabolic function exploration:

    • Glucose tolerance and insulin sensitivity tests

    • Metabolomics profiling in tissue-specific knockout models

    • Glycogen content and metabolism assessments

    • Mitochondrial respiration and glycolytic function measurements

  • Infection biology techniques:

    • Host-pathogen interaction studies

    • Bacterial entry, replication, and exit quantification

    • Temporal manipulation of BNIP3L during infection cycles

    • Comparative studies across pathogen types

  • Systems biology integration:

    • Multi-omics approaches (transcriptomics, proteomics, metabolomics)

    • Network analysis to identify functional hubs

    • Machine learning for pattern recognition in complex datasets

    • Computational modeling of BNIP3L-regulated processes

Recent discoveries have revealed that BNIP3L/NIX regulates both mitophagy and pexophagy, suggesting broader organelle quality control functions. Additionally, muscle-specific knockout models demonstrated that BNIP3L coordinates nuclear calcium signaling, altering NFAT and myostatin signaling pathways with downstream effects on muscle fiber-type and metabolism. Remarkably, these knockout mice showed increased insulin sensitivity with corresponding increases in glycogen-rich muscle fibers, establishing connections between mitochondrial quality control and metabolic regulation .

How might advanced technologies such as single-cell analysis, spatial transcriptomics, and AI-driven predictions advance our understanding of BNIP3L biology?

Advanced technologies are poised to revolutionize our understanding of BNIP3L biology by providing unprecedented resolution, context, and predictive capabilities:

Transformative technologies and their applications to BNIP3L research:

TechnologyCapabilityApplication to BNIP3L ResearchPotential Discoveries
Single-cell RNA-seqTranscriptional heterogeneity at cellular levelCell-specific BNIP3L expression patterns; co-expression networksIdentification of cellular subpopulations with distinct BNIP3L functions
Single-cell proteomicsProtein-level heterogeneity analysisBNIP3L protein expression variability; modification statesPost-translational regulation patterns at single-cell resolution
Spatial transcriptomicsGene expression with spatial contextTissue-specific BNIP3L expression patterns; microenvironmental influencesSpatial relationships between BNIP3L expression and tissue architecture
Live-cell super-resolution microscopyNanoscale visualization of dynamic processesReal-time tracking of BNIP3L-mediated mitophagy; membrane dynamicsNovel spatiotemporal patterns in mitophagy initiation and progression
Cryo-electron tomography3D visualization of cellular ultrastructureBNIP3L localization at membranes; organelle contact sitesStructural basis of organelle tethering and membrane remodeling
AI-driven structure predictionProtein structure and interaction modelingBNIP3L conformational states; binding interface predictionsNovel regulatory mechanisms and interaction partners
Machine learning for image analysisAutomated phenotype quantificationHigh-throughput mitophagy phenotyping; pattern recognitionPreviously undetectable mitophagy signatures and subtypes
Multi-omics integrationHolistic view of biological systemsIntegration of transcriptome, proteome, metabolome dataComprehensive BNIP3L regulatory networks across biological scales
Organoids and microphysiological systems3D tissue models with physiological relevanceOrgan-specific BNIP3L functions; disease modelingTissue-specific regulatory mechanisms in near-physiological conditions
CRISPR screeningHigh-throughput functional genomicsGenetic modifiers of BNIP3L function; synthetic interactionsNew regulatory components and functional connections

Research questions addressable with advanced technologies:

  • Cellular heterogeneity exploration:

    • How does BNIP3L expression and function vary among individual cells within the same tissue?

    • Are there distinct cellular subpopulations that differentially regulate BNIP3L activity?

    • How do microenvironmental factors spatially pattern BNIP3L-mediated processes?

  • Structural and molecular mechanisms:

    • What are the conformational states of BNIP3L in different membrane environments?

    • How do post-translational modifications alter the 3D structure and interactions?

    • Can AI predict novel binding partners based on structural complementarity?

  • Temporal dynamics and regulation:

    • What is the precise sequence of molecular events in BNIP3L-mediated mitophagy?

    • How rapidly do cells respond to fluctuating BNIP3L levels?

    • What feedback mechanisms control BNIP3L activity over time?

  • Complex systems integration:

    • How does BNIP3L function integrate into broader cellular networks?

    • What emergent properties arise from BNIP3L interactions across multiple pathways?

    • How do different tissues utilize BNIP3L in context-specific ways?

  • Translational applications:

    • Can AI approaches identify patient subgroups likely to benefit from BNIP3L-targeted therapies?

    • What biomarkers predict BNIP3L dysregulation in disease states?

    • How can complex datasets guide personalized therapeutic strategies?

Implementation strategy for interdisciplinary BNIP3L research:

An integrated approach might combine:

  • Single-cell and spatial technologies to map BNIP3L expression across tissues

  • AI-driven structure prediction to identify critical regulatory interfaces

  • High-content screening with machine learning analysis to identify modulators

  • Multi-omics integration to construct comprehensive regulatory networks

  • Advanced disease models to validate findings in physiologically relevant contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.