Recombinant Bovine Beta-1 adrenergic receptor (ADRB1)

Shipped with Ice Packs
In Stock

Description

Introduction to Beta-1 Adrenergic Receptor (ADRB1)

Beta-1 adrenergic receptor (ADRB1) is a protein encoded by the ADRB1 gene that belongs to the beta-adrenergic receptor family, a subset of G protein-coupled receptors (GPCRs). These receptors play crucial roles in mediating the effects of catecholamines such as epinephrine and norepinephrine. In bovine species, as in other mammals, ADRB1 facilitates the catecholamine-induced activation of adenylate cyclase through the action of G proteins, leading to increased intracellular levels of cyclic adenosine monophosphate (cAMP) .

The activation of ADRB1 triggers Ras activation through G(s)-alpha- and cAMP-mediated signaling pathways . This signaling cascade regulates various physiological processes including cardiovascular function, metabolism, and adaptations to stress. The receptor is characterized by its seven transmembrane domain structure, which is typical of GPCRs and essential for its function in ligand binding and signal transduction.

In bovine species, beta-adrenergic receptors have attracted significant research interest due to their involvement in processes relevant to livestock production, including growth, metabolism, and adaptation to environmental challenges. The study of recombinant bovine ADRB1 has contributed substantially to our understanding of these processes and has potential applications in improving livestock productivity and welfare.

Gene Structure and Conservation

The bovine ADRB1 gene encodes the Beta-1 adrenergic receptor protein, with its sequence available under the accession number NM_194266.1 . While detailed bovine-specific structural information is limited in the available research, insights can be drawn from the conservation patterns observed across species.

In humans, the ADRB1 gene is located on chromosome 10q25.3, and certain residues like alanine at position 187 (A187) are highly conserved across both vertebrates and invertebrates . This high degree of conservation suggests critical functional roles for these specific amino acids. The conservation of such key residues between species indicates that certain structural elements of ADRB1 are fundamentally important to its function across evolutionary history.

Expression and Distribution of ADRB1 in Bovine Tissues

The distribution of beta-adrenergic receptor subtypes in bovine tissues exhibits significant species-specific patterns. Research has shown that beta-2 adrenergic receptor (β2-AR) is the predominant subtype in bovine adipose tissue, which contrasts with porcine adipose tissue where beta-1 adrenergic receptor (β1-AR) is the primary subtype . This highlights the importance of species-specific research rather than extrapolating findings across different species.

Studies have revealed differences in the expression patterns of adrenergic receptor subtypes between different adipose tissue depots in bovine subjects. Specifically, intramuscular (i.m.) adipose tissue shows minimal mRNA expression of the β1- and β3-subtypes compared to subcutaneous (s.c.) adipose tissue . This differential expression pattern has significant implications for understanding metabolic regulation in different adipose depots in cattle.

The limited expression of ADRB1 in intramuscular adipose tissue likely contributes to the reduced responsiveness of this tissue to beta-adrenergic ligands, especially those that are agonists at the β1-receptor subtype . These findings are important for understanding the differential regulation of metabolism in various bovine tissues and may have implications for meat quality and production efficiency in cattle.

Detection Methods for Bovine ADRB1

For the detection and quantification of bovine ADRB1 mRNA, specific primers have been designed based on the gene sequence. The following table presents the primers used for analyzing ADRB1 expression in bovine tissues:

GeneAccession numberSequenceAmplicon length (bp)
ADRB1NM_194266.1F: 5′-CAGAAGGCACTCAAGACGCT-3′81
R: 5′-CACCACGTTGGCTAGGAAGA-3′

These primers enable the quantitative analysis of ADRB1 mRNA expression using reverse transcription-polymerase chain reaction (RT-PCR) techniques . This approach has been used to study the expression patterns of ADRB1 across different bovine tissues and under various physiological conditions.

Expression Systems

The production of recombinant bovine ADRB1 involves expressing the bovine Adrb1 gene in suitable expression systems. Various systems can be employed for this purpose, each with distinct advantages and limitations:

  1. Bacterial Expression Systems: Escherichia coli (E. coli) systems offer high yields and relatively low costs but may present challenges for proper folding of membrane proteins like ADRB1. Despite these challenges, bacterial systems have been used for expressing segments or modified versions of GPCRs.

  2. Yeast Expression Systems: Systems like Pichia pastoris provide eukaryotic post-translational modifications while maintaining relatively high yields. Although not specifically mentioned for ADRB1, other bovine recombinant proteins have been successfully expressed in Pichia pastoris .

  3. Insect Cell Expression Systems: Baculovirus-infected insect cells offer an environment conducive to proper folding and post-translational modifications of membrane proteins, which is beneficial for complex proteins like GPCRs.

  4. Mammalian Cell Expression Systems: These systems provide the most native-like environment for mammalian proteins, resulting in properly folded and functionally active receptors, albeit typically with lower yields and higher costs.

For studying bovine beta-adrenergic receptors, Chinese Hamster Ovary (CHO) cells have been successfully employed. CHO cells can be transfected with bovine β1-, β2-, or β3-AR constructs in vectors like pcDNA3.1+, with expression confirmed by polymerase chain reaction (PCR) .

Purification and Characterization

After expression, recombinant bovine ADRB1 typically undergoes purification using techniques such as affinity chromatography. This often involves adding affinity tags (such as His-tags) to the recombinant protein to facilitate purification. The purified protein can then be characterized for its structural integrity, ligand binding properties, and functional responses.

Although not specifically for bovine ADRB1, the successful purification and functional characterization of beta-adrenergic receptor kinases from bovine brain has been reported, with recombinant versions showing activity at least equal to preparations from native sources . This demonstrates the feasibility of working with recombinant bovine adrenergic receptor-related proteins and suggests that similar approaches could be applied to ADRB1.

Signaling Mechanisms

Recombinant bovine ADRB1, like its native counterpart, mediates signaling through the activation of adenylate cyclase, leading to increased intracellular cAMP levels. This second messenger then activates downstream pathways, primarily through protein kinase A (PKA)-dependent mechanisms, leading to various cellular responses.

The signaling cascade initiated by ADRB1 activation plays crucial roles in regulating metabolism, particularly lipolysis in adipose tissues. The receptor's ability to activate these pathways can be studied using recombinant systems, providing insights into the molecular mechanisms underlying its physiological effects.

Experimental Approaches for Functional Characterization

For functional characterization of recombinant bovine ADRB1, Chinese Hamster Ovary (CHO) cells transfected with the bovine ADRB1 construct provide a suitable experimental system. After confirming receptor expression, these cells can be used to study the receptor's response to various ligands and downstream signaling events.

The protocol for studying bovine beta-adrenergic receptors in CHO cells involves:

  1. Plating cells into 96-well tissue culture plates at 60,000 cells per well

  2. Growing cells for 48 hours after plating

  3. Adding ligands and determining cAMP accumulation as a measure of receptor activation

This approach allows researchers to characterize the pharmacological properties of the recombinant receptor, including its affinity for various ligands and its efficacy in activating downstream signaling pathways.

Tissue-Specific Response Patterns

Studies with bovine tissues have revealed differential responsiveness to beta-adrenergic ligands. Specifically, bovine intramuscular adipose tissue is less responsive than subcutaneous adipose tissue to beta-adrenergic ligands, especially those that are agonists at the β1- and β3-receptor subtypes .

This differential responsiveness correlates with the minimal mRNA expression of the β1- and β3-subtypes in intramuscular adipose tissue, which likely limits the response potential to agonists for these beta-adrenergic receptor subtypes . These findings highlight the importance of tissue-specific studies when investigating bovine ADRB1 function and have implications for understanding the differential regulation of metabolism in various bovine tissues.

Pharmacological Studies

Recombinant bovine ADRB1 enables the screening and characterization of compounds that interact with this receptor. This includes evaluating both natural ligands (epinephrine, norepinephrine) and synthetic compounds for their agonistic or antagonistic properties.

Studies have evaluated synthetic beta-adrenergic ligands, such as lubabegron fumarate, assessing their interaction with multiple receptor systems including the β1-AR . According to in vitro and in vivo pharmacology studies, lubabegron fumarate has antagonistic activity to the β1- and β2-ARs while showing agonistic activity to the β3-AR . Such studies contribute to our understanding of receptor-ligand interactions and may lead to the development of compounds with veterinary applications.

Metabolic Research

Given the role of beta-adrenergic receptors in regulating metabolism, particularly in adipose tissues, recombinant bovine ADRB1 facilitates studies on metabolic processes in bovine subjects. This includes investigating lipolysis, which is a key metabolic process regulated by beta-adrenergic signaling .

The differential expression and function of ADRB1 in various bovine adipose depots make it particularly relevant for understanding the regulation of lipid metabolism in cattle. These studies have potential implications for meat quality and production efficiency in the livestock industry.

Comparative Studies

Recombinant bovine ADRB1 enables comparative studies with ADRB1 from other species, contributing to our understanding of species-specific differences in receptor structure, function, and pharmacology. These comparisons are crucial for developing species-specific therapeutic approaches and for understanding the evolutionary conservation and divergence of adrenergic signaling systems.

For instance, studies have revealed that while β2-AR is the predominant subtype in bovine adipose tissue, β1-AR is the primary subtype in porcine adipose tissue . Additionally, the synthetic ligand ICI118,551 functions as an antagonist for β2-AR in bovine tissues but has no effect on β2-AR in porcine adipose tissue . These species differences highlight the importance of targeted, species-specific research.

Recombinant Proteins and Antibodies

While the search results don't specifically list commercially available recombinant bovine ADRB1 proteins, they do mention availability of various ADRB1-related reagents. For research purposes, companies like CUSABIO supply a range of ADRB1 reagents manufactured under strict quality control systems .

For human ADRB1, multiple recombinant protein forms are available from different expression systems:

CodeProduct NameSource
CSB-YP001391HURecombinant Human Beta-1 adrenergic receptor (ADRB1), partialYeast
CSB-EP001391HU CSB-BP001391HU CSB-MP001391HU CSB-EP001391HU-BRecombinant Human Beta-1 adrenergic receptor (ADRB1)E.coli Baculovirus Mammalian cell In Vivo Biotinylation in E.coli
CSB-CF001391HU(A4)Recombinant Human Beta-1 adrenergic receptor (ADRB1)in vitro E.coli expression system
CSB-MP001391HU(A4)Recombinant Human Beta-1 adrenergic receptor(ADRB1)-VLPsMammalian cell

Similar approaches could be used for producing recombinant bovine ADRB1, with the choice of expression system depending on the specific requirements for proper folding, post-translational modifications, and functional activity.

Research Tools

Various tools for ADRB1 research are commercially available, including:

  1. PCR Primers: Primers for the detection and quantification of bovine ADRB1 mRNA have been designed based on the gene sequence (accession number NM_194266.1) .

  2. Antibodies: While the search results primarily mention antibodies for human ADRB1, these might show cross-reactivity with bovine ADRB1 due to the conservation of key epitopes across species.

  3. Cell Lines: Cell lines expressing recombinant bovine ADRB1, such as transfected CHO cells, provide valuable tools for studying receptor function and for screening compounds that interact with the receptor.

Current Research Focus

Current research involving recombinant bovine ADRB1 focuses on several key areas:

  1. Receptor Pharmacology: Characterizing the binding and functional properties of the receptor with various ligands, both natural and synthetic, to understand its pharmacological profile.

  2. Tissue-Specific Signaling: Investigating how ADRB1 signaling differs among various bovine tissues, particularly adipose depots with differing metabolic characteristics. The finding that bovine intramuscular adipose tissue is less responsive than subcutaneous adipose tissue to β1-AR agonists highlights the importance of such tissue-specific studies.

  3. Development of Selective Modulators: Designing and evaluating compounds that selectively target bovine ADRB1 for potential veterinary applications, particularly in livestock production.

Future Research Directions

Potential future directions in recombinant bovine ADRB1 research include:

  1. Structural Studies: Detailed characterization of the receptor's structure using techniques like X-ray crystallography or cryo-electron microscopy could provide insights into ligand binding and activation mechanisms.

  2. Genetic Variations: Investigating genetic polymorphisms in the bovine Adrb1 gene and their associations with production traits could lead to marker-assisted selection strategies for improving livestock productivity.

  3. Development of Improved Expression Systems: Optimizing expression systems for higher yields and better functional properties of recombinant bovine ADRB1 would enhance its utility as a research tool.

  4. Applications in Precision Livestock Farming: Understanding the role of ADRB1 in bovine physiology could contribute to developing targeted interventions for improving animal health and productivity in the context of precision livestock farming.

Expression and Purification Methods

The expression and purification of recombinant bovine ADRB1 typically involve several key steps:

  1. Cloning: The bovine Adrb1 gene is cloned into an appropriate expression vector, often with the addition of affinity tags to facilitate purification.

  2. Transfection/Transformation: The expression construct is introduced into the chosen host system (bacterial, yeast, insect, or mammalian cells). For beta-adrenergic receptor studies, Chinese Hamster Ovary cells have been successfully transfected with bovine β1-AR constructs in pcDNA3.1+ vectors .

  3. Expression Confirmation: Expression of the β-AR is confirmed by polymerase chain reaction (PCR) , ensuring that the host cells are producing the recombinant protein.

  4. Functional Testing: For recombinant GPCRs like ADRB1, functional activity is often assessed directly in the expression system before purification, as membrane proteins can be challenging to purify while maintaining native conformation and activity.

Functional Assays

Various assays can be employed to study the functional properties of recombinant bovine ADRB1:

  1. cAMP Accumulation Assays: Since ADRB1 activation leads to increased cAMP production through adenylate cyclase activation, measuring cAMP levels provides a direct readout of receptor activity. Cells expressing recombinant bovine ADRB1 can be exposed to various ligands, and the resulting cAMP accumulation can be measured .

  2. Ligand Binding Assays: These assess the binding affinity of various compounds to the recombinant receptor, providing information about the receptor's pharmacological profile.

  3. Downstream Signaling Assays: These assess the activation of pathways downstream of ADRB1, such as protein kinase A (PKA) activation and subsequent cellular responses.

  4. Tissue-Specific Response Studies: Comparing the responses of different bovine tissues or cell types to beta-adrenergic stimulation provides insights into the tissue-specific functions of ADRB1. Studies have shown, for instance, that bovine intramuscular adipose tissue is less responsive than subcutaneous adipose tissue to beta-adrenergic agonists .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADRB1; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-467
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MGAGVLALGASEPCNLSSAAPVPDGAATAARLLVPASPPASLLTSASEGPPLPSQQWTAG MGLLMAFIVLLIVVGNVLVLVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARALVC TVWAISALVSFLPIFMQWWGDKDAKASRCYNDPECCDFIINEGYAITSSVVSFYVPLCIM AFVYLRVFREAQKQVKKIDSCERRFLSGPARLPSPAPSPGPPLPAATVANGRANKRRPPR LVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSAFN PIIYCRSPDFRKAFQRLLCCARRAACGSHAAAGDPPRALGCLAVARPSPSPGAASDDDDD DDEDDVGAAPPVRLLEPWAGYNGGAAANSDSSPDEPSRAGCASESKV
Uniprot No.

Target Background

Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. It mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling. Beta-adrenergic receptors are involved in the regulation of sleep/wake behaviors.
Gene References Into Functions
  1. Among the beta-adrenergic receptors, adrenergic beta(2)-receptor type was most highly expressed in the mammary gland of dairy cows, followed by beta(1) and beta(3) PMID: 12586313
  2. Beta 1, 2, and 3-adrenergic receptors in cattle were positively associated with hepatic activities of gluconeogenetic enzymes and with plasma glucose levels, suggesting functional importance PMID: 15760672
Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome.

Q&A

What are the key functional domains and motifs essential for bovine ADRB1 activity?

Bovine ADRB1 contains several critical functional domains and motifs that are essential for its proper functioning. The receptor's structure includes seven transmembrane domains characteristic of G protein-coupled receptors, with the third intracellular loop and C-terminal tail being crucial for G protein coupling and downstream signaling . Key residues like Gln237, Thr291, and Phe147 in the intracellular loop 2 (ICL2) have been identified as critical for G protein interaction and cAMP signaling based on mutagenesis studies . The receptor's extracellular N-terminal region contains glycosylation sites that influence receptor trafficking and stability. The ligand-binding pocket, formed by transmembrane helices, contains conserved residues that interact directly with agonists and antagonists, determining binding affinity and specificity. These structural elements collectively enable the conformational changes necessary for signal transduction upon ligand binding, with mutations in these regions significantly impairing cAMP signaling in response to agonists with different efficacies .

How do post-translational modifications affect bovine ADRB1 function?

Post-translational modifications play critical roles in regulating bovine ADRB1 function, trafficking, and signaling properties. Glycosylation of ADRB1 occurs at specific N-terminal residues and affects the receptor's expression at the cell surface and molecular weight on Western blots (observed at approximately 55 kDa versus the predicted 51 kDa) . Phosphorylation by G protein-coupled receptor kinases (GRKs) and other kinases at serine and threonine residues in the C-terminal region and third intracellular loop regulates receptor desensitization and internalization following prolonged agonist exposure. This phosphorylation promotes the recruitment of β-arrestins, uncoupling the receptor from G proteins and facilitating receptor internalization. Palmitoylation of cysteine residues in the C-terminal tail anchors this region to the plasma membrane, creating a fourth intracellular loop that affects G protein coupling efficiency. Ubiquitination influences receptor degradation pathways, determining whether internalized receptors are recycled back to the plasma membrane or directed to lysosomes for degradation. Understanding these modifications is essential for interpreting experimental results and designing studies to manipulate receptor function.

What expression systems are most effective for producing functional recombinant bovine ADRB1?

Several expression systems have been employed for producing functional recombinant bovine ADRB1, each with distinct advantages and limitations. Mammalian cell systems, particularly HEK293 and CHO cells, provide the most native-like post-translational modifications and chaperone proteins necessary for proper folding and trafficking of ADRB1 to the plasma membrane . These systems are especially valuable for functional studies requiring intact signaling pathways, though they typically yield lower protein quantities compared to other systems. Insect cell systems using Sf9 or High Five cells infected with baculovirus vectors offer a compromise between proper folding and higher expression levels, making them suitable for structural studies and biochemical assays. Escherichia coli bacterial systems can produce high quantities of receptor protein but often result in inclusion bodies requiring refolding procedures that may compromise functional integrity. Consequently, bacterial systems are less suitable for full-length ADRB1 but may be useful for expressing soluble domains. Yeast systems like Pichia pastoris represent an intermediate option, offering eukaryotic processing with higher yields than mammalian cells, though glycosylation patterns differ from bovine native patterns.

What are the key challenges in maintaining native conformation during purification of recombinant bovine ADRB1?

Maintaining the native conformation of recombinant bovine ADRB1 during purification presents several significant challenges due to its intrinsic properties as a membrane protein. The hydrophobic transmembrane domains tend to aggregate in aqueous solutions, necessitating careful selection of detergents to solubilize the receptor while preserving its structural integrity . Common detergents like n-dodecyl-β-D-maltoside (DDM) and lauryl maltose neopentyl glycol (LMNG) have proven effective, but optimization is required for each preparation. The receptor's conformational flexibility, which is essential for its function, makes it inherently unstable during purification processes. Ligand addition during purification can stabilize specific conformational states, with full agonists generally providing more stabilization than partial agonists or antagonists . Temperature sensitivity is another critical factor, with most protocols requiring all steps to be performed at 4°C to prevent denaturation. Additionally, proteolytic degradation poses a significant challenge, requiring protease inhibitor cocktails throughout the purification process. The presence of multiple post-translational modifications further complicates purification, as these modifications may be heterogeneous and affect the receptor's biochemical properties and activity.

How can researchers optimize yield and stability of recombinant bovine ADRB1?

Optimizing the yield and stability of recombinant bovine ADRB1 requires a multifaceted approach addressing several critical factors in the expression and purification process. Expression construct design should include affinity tags (such as His6 or FLAG) for efficient purification, with the potential addition of fusion partners like T4 lysozyme or BRIL that enhance expression and stability . The expression system should be carefully selected based on research needs, with mammalian cells providing better functionality and insect cells offering higher yields. Cell culture conditions require optimization of temperature, induction timing, and duration, with lower temperatures (28-30°C) often improving proper folding over maximal expression. Addition of pharmacological chaperones or antagonists during expression can significantly enhance receptor stability by preventing misfolding and aggregation. Detergent selection is crucial, with mild detergents like DDM or LMNG generally preferred, while cholesterol hemisuccinate (CHS) supplementation helps maintain the lipid environment necessary for stability. Purification conditions should be optimized for pH, salt concentration, and glycerol content to prevent aggregation. For long-term storage, reconstitution into lipid nanodiscs or proteoliposomes often provides superior stability compared to detergent micelles, preserving both structure and function.

What are the most reliable assays for measuring bovine ADRB1 signaling activity?

Several robust assays have been developed for measuring bovine ADRB1 signaling activity, each with specific advantages depending on the research question. cAMP accumulation assays represent the gold standard for quantifying ADRB1 activation, as this receptor primarily signals through Gs-mediated increases in adenylyl cyclase activity . These assays employ either radioimmunoassay approaches or more modern FRET/BRET-based biosensors that provide real-time, spatially resolved measurements of cAMP dynamics. GTPγS binding assays directly measure the receptor-induced nucleotide exchange on G proteins, offering a proximal readout of receptor activation that can detect subtle differences in agonist efficacy. Bioluminescence or fluorescence resonance energy transfer (BRET/FRET) assays enable real-time monitoring of receptor-G protein interactions or conformational changes within the receptor itself, providing mechanistic insights into activation dynamics . Calcium mobilization assays can be used when ADRB1 is artificially coupled to Gq proteins or when measuring calcium release downstream of cAMP signaling. Receptor internalization assays using fluorescently tagged receptors allow evaluation of receptor trafficking and desensitization dynamics. Each assay type provides different insights into receptor function, with combinations of multiple assay formats often necessary for comprehensive characterization.

How can researchers effectively study ADRB1-mediated downstream signaling in bovine tissues?

Studying ADRB1-mediated downstream signaling in bovine tissues requires a combination of approaches that capture both the molecular events and physiological outcomes of receptor activation. Ex vivo tissue preparations, including cardiac muscle strips, isolated arteries, or adipose tissue explants, provide physiologically relevant models for measuring ADRB1-specific responses like contractility changes (positive inotropic and chronotropic effects in cardiac tissue) or lipolysis in adipose tissue . Immunohistochemistry using specific antibodies can reveal the spatial distribution of ADRB1 and associated signaling components in tissue sections, as demonstrated with preparations showing β1-AR expression patterns in cardiac tissues . Phospho-specific antibodies enable detection of activated downstream kinases like PKA and its substrates, providing a readout of the signaling cascade. Western blotting of tissue lysates can quantify changes in expression levels of ADRB1 and signaling proteins in response to physiological states or pharmacological interventions . Receptor autoradiography with radiolabeled ligands offers quantitative mapping of receptor distribution and density across tissues. For mechanistic studies, primary cell cultures derived from bovine tissues maintain many native signaling components while allowing more controlled experimental manipulations than whole tissues. RNA sequencing or qPCR analysis of tissues from animals treated with ADRB1 agonists/antagonists can reveal transcriptional responses regulated by this receptor pathway .

What are the best approaches for studying bovine ADRB1 interactions with other proteins?

Several complementary approaches can be employed to study interactions between bovine ADRB1 and other proteins, with each method providing unique insights into the molecular basis of these interactions. Co-immunoprecipitation experiments represent a fundamental approach, where antibodies against ADRB1 or potential interaction partners are used to isolate protein complexes from bovine tissue or cell lysates, followed by Western blot analysis to detect associated proteins . Proximity ligation assays (PLA) offer in situ detection of protein interactions with high sensitivity, visualizing ADRB1 interactions within their native cellular context. FRET/BRET-based methods enable real-time monitoring of dynamic protein interactions in living cells, as demonstrated in studies examining ADRB1 interactions with G proteins and other signaling molecules like 14-3-3 proteins . Surface plasmon resonance or isothermal titration calorimetry with purified components provides quantitative binding parameters including affinity constants and thermodynamic properties. Cross-linking mass spectrometry approaches can map specific residues involved in protein-protein interactions, offering structural insights at the amino acid level. Yeast two-hybrid or mammalian two-hybrid systems are valuable for initial screening of potential interaction partners. The research on 14-3-3ε interaction with ADRB1 illustrates how these approaches can reveal novel regulatory mechanisms, showing that ADRB1 competes with HERG potassium channels for 14-3-3ε binding, thereby modulating channel activity .

How do polymorphisms in bovine ADRB1 affect receptor function and drug responses?

Polymorphisms in bovine ADRB1 significantly impact receptor function and pharmacological responses, creating important considerations for both basic research and agricultural applications. The Arg389Gly polymorphism, one of the most studied ADRB1 variants, substantially alters receptor signaling capacity, with the Arg389 variant displaying adenylyl cyclase activities 2-3 fold higher than the Gly389 variant in response to agonist stimulation . This enhanced signaling capacity translates to differential responses to beta-blockers, with individuals carrying the Arg389Arg genotype generally showing greater therapeutic responses to these medications . The Ser49Gly polymorphism primarily affects receptor regulation mechanisms, with the Gly49 allele exhibiting greater agonist-mediated receptor down-regulation compared to the Ser49 variant . Consequently, the Ser49Ser genotype typically demonstrates enhanced responsiveness to beta-blockers due to its resistance to down-regulation. These polymorphisms can influence physiological parameters like blood pressure regulation and heart rate, as well as responses to stress and exercise . In experimental settings, researchers must account for these genetic variations when designing studies and interpreting results, particularly when comparing findings across different animal populations or translating results to human applications.

What methodologies are most effective for genotyping bovine ADRB1 polymorphisms?

Several robust methodological approaches are available for genotyping bovine ADRB1 polymorphisms, each with specific advantages depending on scale, cost, and accuracy requirements. PCR-RFLP (Restriction Fragment Length Polymorphism) provides a cost-effective method for moderate-scale genotyping, where specific restriction enzymes cleave PCR-amplified DNA fragments at sites affected by the polymorphisms, generating distinct fragment patterns for different genotypes . Allele-specific PCR employs primers designed to selectively amplify specific allelic variants, enabling direct visualization of genotypes through gel electrophoresis. Real-time PCR with TaqMan probes or high-resolution melting analysis offers higher throughput capabilities with reduced hands-on time, utilizing fluorescent probes or dyes that distinguish between allelic variants based on melting temperature differences. Sanger sequencing remains the gold standard for accuracy and can detect novel variants, though at higher cost per sample. For large-scale studies, next-generation sequencing approaches enable multiplexed analysis of numerous samples and polymorphisms simultaneously. Custom SNP arrays represent another high-throughput option for population studies examining multiple polymorphisms. Statistical validation of genotyping accuracy should include assessment of Hardy-Weinberg equilibrium, as demonstrated in studies examining ADRB1 polymorphisms in relation to drug responses .

How do ADRB1 polymorphisms correlate with physiological responses in cattle?

ADRB1 polymorphisms exhibit significant correlations with various physiological responses in cattle, impacting both production traits and therapeutic interventions. Studies focusing on the Arg389Gly polymorphism have demonstrated that animals with the Arg389Arg genotype typically display enhanced β-adrenergic signaling responses, resulting in stronger contractility responses in cardiac tissue and potentially affecting cardiac output and exercise capacity . This polymorphism influences plasma renin activity (PRA) levels, with significant differences observed between genotypes at rest and during exercise, suggesting implications for fluid balance regulation and blood pressure control . The Ser49Gly polymorphism affects receptor down-regulation dynamics, with consequences for sustained adrenergic stimulation scenarios like stress responses or long-term medication effects. In studies examining metoprolol response, a significant genotype-dependent dose-response relationship has been observed, with Gly/Gly subjects showing decreased PRA with increasing metoprolol concentration - an effect not observed in Arg/Arg or Arg/Gly subjects . These genetic variations may contribute to individual differences in growth patterns, feed efficiency, and metabolic profiles in cattle, particularly when animals are subjected to β-adrenergic agonist supplementation. The polymorphisms also influence lipolytic responses to catecholamines in adipose tissue, potentially affecting body composition and fat deposition patterns .

How can recombinant bovine ADRB1 be used for drug discovery and characterization?

Recombinant bovine ADRB1 serves as a valuable tool for drug discovery and characterization through several well-established approaches. High-throughput binding assays using purified recombinant ADRB1 enable rapid screening of compound libraries to identify novel ligands with desired binding properties, including determination of affinity constants and kinetic parameters . Functional assays measuring G protein activation or cAMP production in cells expressing recombinant bovine ADRB1 allow classification of compounds as agonists, antagonists, or inverse agonists, while providing efficacy and potency values . Structure-based drug design approaches, informed by crystallographic or cryo-EM structures of ADRB1 complexed with ligands and G proteins, facilitate rational design of compounds with optimized binding properties and signaling profiles . Ligand bias screening using multiple signaling assays can identify compounds that selectively activate specific signaling pathways downstream of ADRB1, potentially reducing unwanted side effects. Species comparison studies using both bovine and human ADRB1 help predict translational potential of compounds identified in bovine models. Molecular dynamics simulations with docked compounds provide insights into ligand-receptor interactions and conformational changes induced by different ligand classes . The development of STD-101-D1, a functionally selective partial agonist of ADRB1 with brain permeability, exemplifies how recombinant receptor systems can lead to compounds with therapeutic potential for neuroinflammatory disorders .

What are the key considerations when designing experiments to study ADRB1 ligand efficacy and bias?

Designing experiments to evaluate ADRB1 ligand efficacy and bias requires careful consideration of multiple factors to ensure robust and physiologically relevant results. Reference compound selection is crucial, with isoproterenol commonly used as a full agonist benchmark for efficacy comparisons, while other compounds like dobutamine (partial agonist) and cyanopindolol (very weak partial agonist) serve as reference points for intermediate efficacy levels . Multiple signaling pathway assessment is essential for detecting ligand bias, requiring parallel measurement of different pathways (G protein activation, cAMP production, β-arrestin recruitment, receptor internalization) under identical conditions . Concentration-response relationships must be fully characterized across a broad range of concentrations to accurately determine both potency (EC50) and efficacy (Emax) parameters. Time-course measurements are important as pathway kinetics differ substantially, with G protein signaling typically occurring more rapidly than arrestin recruitment. System considerations like receptor expression levels, G protein stoichiometry, and effector availability significantly impact observed efficacy and bias, requiring careful control and reporting of these parameters. Mathematical modeling approaches like operational models or relative activity scales enable quantitative comparison of pathway activation across different assays with varying amplification. The choice of experimental readout (proximity assays, second messenger accumulation, reporter gene expression) introduces different levels of signal amplification and temporal resolution that must be accounted for when interpreting results .

How can CRISPR-Cas9 technology be applied to study bovine ADRB1 function?

CRISPR-Cas9 technology offers powerful approaches for investigating bovine ADRB1 function through precise genetic manipulation. Gene knockout strategies represent the most straightforward application, where CRISPR-Cas9 introduces frameshift mutations or premature stop codons in the ADRB1 gene, enabling studies of phenotypes in complete absence of the receptor . Knock-in approaches allow introduction of specific mutations corresponding to naturally occurring polymorphisms (such as Arg389Gly or Ser49Gly) to study their functional consequences in an isogenic background . Tagging endogenous ADRB1 with fluorescent proteins or epitope tags via precise knock-in editing enables visualization of receptor trafficking and protein-protein interactions at physiological expression levels. Domain swapping between bovine and human ADRB1 through CRISPR-mediated homologous recombination helps identify species-specific functional domains that contribute to differences in pharmacological responses or regulatory mechanisms. Base editing or prime editing technologies permit introduction of specific nucleotide changes without double-strand breaks, enabling more efficient creation of disease-relevant mutations. Inducible expression systems combined with CRISPR can generate conditional knockouts where ADRB1 expression can be eliminated in specific tissues or at specific developmental stages. CRISPR interference (CRISPRi) or CRISPR activation (CRISPRa) approaches offer opportunities for reversible modulation of ADRB1 expression without permanent genetic changes, allowing temporal studies of receptor function.

What are the emerging technologies for studying ADRB1 conformational dynamics?

Emerging technologies are revolutionizing our ability to study ADRB1 conformational dynamics, providing unprecedented insights into receptor function. Cryo-electron microscopy (cryo-EM) has emerged as a powerful approach for determining high-resolution structures of ADRB1 in complex with various ligands and signaling partners, revealing conformational states associated with different functional outcomes . Single-molecule FRET (smFRET) enables real-time monitoring of conformational changes in individual receptor molecules, capturing the dynamic equilibrium between different states and revealing how ligands shift these equilibria. Double electron-electron resonance (DEER) spectroscopy with site-specifically labeled receptors provides distance measurements between labeled residues, mapping conformational changes induced by different ligands with angstrom-level precision. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) identifies regions of altered solvent accessibility upon ligand binding or protein-protein interactions, providing insights into conformational changes across the entire receptor. Molecular dynamics simulations utilizing advanced computing resources enable in silico prediction of receptor dynamics at microsecond to millisecond timescales, complementing experimental approaches . Nanobody-based sensors, derived from camelid antibodies, can selectively recognize and stabilize specific conformational states of ADRB1, facilitating their structural characterization. Native mass spectrometry preserves non-covalent interactions during analysis, enabling study of intact receptor-ligand complexes and their conformational heterogeneity. These complementary approaches collectively provide a comprehensive view of how ADRB1 converts extracellular signals into intracellular responses through conformational rearrangements.

How can systems biology approaches enhance our understanding of bovine ADRB1 signaling networks?

Systems biology approaches offer comprehensive frameworks for understanding bovine ADRB1 signaling networks in their full complexity. Multi-omics integration combining transcriptomics, proteomics, phosphoproteomics, and metabolomics data from bovine tissues or cells following ADRB1 activation provides a holistic view of signaling consequences across multiple cellular processes . Mathematical modeling of ADRB1 signaling pathways incorporating receptor states, G protein coupling, effector activation, and feedback mechanisms enables prediction of system responses to different stimuli and perturbations. Network analysis identifies key nodes and motifs within the ADRB1 signaling network, highlighting potential control points and cross-talk with other signaling pathways. Single-cell approaches reveal cell-to-cell variability in ADRB1 expression and signaling responses within heterogeneous tissues, uncovering potential subpopulations with distinct functional characteristics. Experimental validation using combinatorial perturbations (multiple gene knockdowns or pharmacological inhibitors) tests model predictions and reveals emergent properties of the signaling network. Spatiotemporal analysis using biosensors and advanced imaging techniques captures the dynamic organization of signaling components in cellular microdomains. Comparative systems approaches examining ADRB1 signaling across different bovine tissues or physiological states identify context-dependent signaling mechanisms. These systems-level insights extend our understanding beyond linear pathways to comprehend how ADRB1 signaling integrates with broader cellular networks to produce physiological outcomes in different contexts.

What controls are essential when conducting experiments with recombinant bovine ADRB1?

Implementing appropriate controls is crucial for ensuring the reliability and interpretability of experiments involving recombinant bovine ADRB1. Expression system validation controls should include wild-type versus mock-transfected cells to account for endogenous receptor expression and signaling components that might confound interpretation of results . Pharmacological controls using selective antagonists (such as CGP 20712A for β1-selective antagonism) confirm that observed responses are specifically mediated through ADRB1 rather than other adrenergic receptors. Negative and positive allosteric modulator controls help distinguish orthosteric from allosteric effects when characterizing novel compounds. Receptor expression level controls using quantitative measures (radioligand binding, flow cytometry, or Western blotting) ensure comparable receptor densities across experimental conditions, as expression levels significantly impact observed efficacy and potency measurements . Dose-response curves with reference compounds (isoproterenol as full agonist, dobutamine as partial agonist) provide benchmarks for interpreting the activity of test compounds . Time-course controls account for potential differences in signaling kinetics, receptor desensitization, or downstream feedback mechanisms. Vehicle controls (solvents used for compound dissolution) identify potential non-specific effects on cellular responses. Genotype controls when studying polymorphic variants ensure that observed functional differences are attributable to the specific genetic variation rather than background differences . These controls collectively strengthen experimental rigor and facilitate accurate interpretation of results obtained with recombinant bovine ADRB1.

How should researchers address potential species differences when translating bovine ADRB1 findings?

Addressing species differences is essential when translating findings from bovine ADRB1 studies to other species, particularly humans. Sequence comparison analysis should be performed to identify conserved and divergent regions between bovine and target species ADRB1, with particular attention to the ligand-binding pocket, G protein coupling interface, and regulatory phosphorylation sites . Parallel pharmacological characterization using standardized assays with identical compounds across species variants helps quantify differences in binding affinity, potency, efficacy, and signaling bias . Key polymorphism analysis is important as functional consequences of genetic variants like Arg389Gly may differ between species due to interactions with other genetic factors or physiological contexts . Cellular context considerations are crucial since differences in G protein subtypes, GRK isoforms, or downstream effectors between species can significantly alter receptor signaling outcomes. Tissue expression pattern comparison helps identify potential differences in receptor distribution that might affect physiological responses or drug effects at the organ system level. Interspecies chimeric receptors, where domains from different species are swapped, can pinpoint regions responsible for observed functional differences. Mathematical modeling approaches can predict how species-specific differences in receptor properties might translate to altered drug responses at the physiological level. These approaches collectively provide a framework for rational translation of bovine ADRB1 findings to other species, enhancing the predictive value of studies using bovine models.

What are the critical factors for reproducibility in ADRB1 signaling assays?

Ensuring reproducibility in ADRB1 signaling assays requires rigorous attention to several critical factors throughout the experimental workflow. Receptor expression system standardization is essential, with consistent cell lines, expression vectors, and transfection/infection protocols to maintain uniform receptor densities and post-translational modification patterns . Ligand quality control through verification of compound identity, purity, and stability prevents variability due to degradation products or contaminants. Assay buffer composition significantly impacts receptor conformational stability and G protein coupling efficiency, requiring precise control of pH, ionic strength, and divalent cation concentrations. Temperature control during assay execution is critical as ADRB1 signaling kinetics are highly temperature-dependent. Timing standardization for measurements is necessary due to the dynamic nature of signaling responses, which evolve over seconds to hours depending on the pathway. Signal detection method calibration with appropriate standards ensures consistent quantification across experiments and laboratories. Data normalization approaches should be clearly defined and consistently applied, particularly when calculating relative efficacies or bias factors. Reporting standards should include comprehensive documentation of experimental conditions, including cell passage number, receptor density, assay sensitivity parameters, and raw data alongside normalized results. Inter-laboratory validation studies comparing results obtained using standardized protocols across different research groups can identify subtle variables affecting reproducibility. Statistical approach standardization is also important, with consistent methods for curve fitting, outlier identification, and significance testing to ensure comparable data interpretation .

What are the main technical challenges in working with recombinant bovine ADRB1?

Working with recombinant bovine ADRB1 presents several significant technical challenges that researchers must address to obtain reliable results. Maintaining native conformation during purification represents perhaps the most formidable challenge, as the receptor's seven-transmembrane domain structure is highly sensitive to detergent extraction, often leading to denaturation or functional impairment . Expression level optimization presents difficulties in balancing sufficient protein yield with proper folding and trafficking, particularly when using heterologous expression systems that may lack bovine-specific chaperones or post-translational modification machinery . Functional stability in experimental conditions is problematic due to the receptor's inherent conformational flexibility, which while essential for function, contributes to instability during extended experimental protocols. Post-translational modification heterogeneity, including variable glycosylation patterns, introduces another layer of complexity that can affect receptor properties and experimental reproducibility . Reconstruction of native-like lipid environments for functional studies requires careful optimization of lipid composition to support proper receptor dynamics. Establishing reliable readouts for conformational states presents challenges due to the subtle nature of conformational changes associated with different activity states. The development of antibodies with suitable specificity and affinity for bovine ADRB1 is complicated by high sequence conservation among adrenergic receptor subtypes. Addressing these technical challenges requires multidisciplinary approaches combining protein engineering, biophysical methods, and pharmacological expertise.

What emerging research directions are advancing our understanding of bovine ADRB1 biology?

Several emerging research directions are significantly advancing our understanding of bovine ADRB1 biology, opening new frontiers in both basic science and applied fields. G protein-biased signaling exploration is revealing how specific ligands can selectively activate G protein pathways while minimizing β-arrestin recruitment, potentially leading to drugs with improved therapeutic profiles and fewer side effects . Integrative structural biology approaches combining cryo-EM, computational modeling, and spectroscopic methods are elucidating the dynamic conformational landscape of ADRB1 and how it relates to functional outcomes . Tissue-specific signaling mechanisms research is uncovering how the same receptor produces distinct physiological responses in different tissues through interaction with tissue-specific signaling partners or effectors . Advanced genetic models using CRISPR/Cas9 technology to introduce specific ADRB1 variants are providing insights into the phenotypic consequences of receptor polymorphisms in consistent genetic backgrounds. Exosome-mediated ADRB1 signaling is emerging as a novel mechanism by which adrenergic stimulation in one cell type can influence distant cells through receptor-containing extracellular vesicles. Multi-omics profiling of ADRB1-mediated responses is revealing the comprehensive cellular consequences of receptor activation beyond classical cAMP pathways . Cross-talk with inflammatory pathways is being recognized as an important aspect of ADRB1 biology, with implications for diseases involving both systems . These research directions collectively promise to transform our understanding of ADRB1 biology from a simple on/off switch to a sophisticated signaling hub integrated within complex cellular networks.

How might advancements in ADRB1 research impact veterinary medicine and livestock production?

Advancements in bovine ADRB1 research hold significant promise for transformative impacts on veterinary medicine and livestock production through several emerging applications. Precision pharmacology approaches utilizing knowledge of ADRB1 polymorphisms could enable genotype-guided selection of medications and dosages for treating cardiovascular conditions in cattle, optimizing therapeutic outcomes while minimizing adverse effects . Stress resilience enhancement through targeted modulation of ADRB1 signaling could improve animal welfare and productivity, particularly in intensive production systems where environmental stressors significantly impact health and performance. Metabolic efficiency improvement leveraging the role of ADRB1 in energy metabolism could lead to strategies for optimizing feed conversion and reducing environmental impacts of livestock production . Reproductive performance optimization might be achieved by better understanding ADRB1's role in ovarian and uterine function, potentially addressing fertility challenges in high-producing dairy cattle. Cardiorespiratory disease management could benefit from novel ADRB1-targeted therapeutics with improved efficacy and reduced side effects based on biased signaling principles . Growth performance modulation through selective ADRB1 signaling pathway activation could provide alternatives to traditional beta-agonist growth promoters with fewer concerns regarding residues or side effects . Diagnostic applications utilizing ADRB1 as a biomarker could enable earlier detection of stress-related conditions or metabolic disorders before clinical signs appear. These potential applications highlight the translational importance of fundamental research on bovine ADRB1 structure, function, and regulation for addressing practical challenges in animal health and production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.