Recombinant Bovine Brain protein 44-like protein 2

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Mitochondrial pyruvate carrier-like protein; Brain protein 44-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Protein Sequence
MAAVVALCRKAMETVKTKEFRDYLASTHFWGPVANWGLPLAAFRDMRASPDIISGRMTTA LIFYSMAFMRFAYRVQPRNLLLMACHGTNIVAQSMQAGRYLNYHYGGGTTAATTAAVSAA SATSTGSVDSSATSTGSVDSSATSTGSVDSSAATTPAAEDPVAHSNCQEITCCYLVTWDC D
Uniprot No.

Target Background

Function
May mediate pyruvate uptake into mitochondria.
Database Links
Protein Families
Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Bovine Brain protein 44-like protein 2 and what cellular functions does it serve?

Bovine Brain protein 44-like protein 2 (BRP44) is also known as Mitochondrial pyruvate carrier 2 (MPC2). It belongs to the Mitochondrial Pyruvate Carrier protein family and plays a critical role in transporting pyruvate across the inner mitochondrial membrane before the pyruvate dehydrogenase reaction . This transport function is essential for cellular energy metabolism as it facilitates the entry of pyruvate into the TCA cycle.

The protein is encoded by the MPC2 gene in humans and has homologs in other species with high conservation. While BRP44 (MPC2) should not be confused with BRP44L (MPC1), both proteins work together in pyruvate transport. Understanding the structure-function relationship of this protein provides insights into mitochondrial metabolism regulation.

What are the optimal storage and handling conditions for recombinant Bovine BRP44?

Recombinant Bovine BRP44 requires specific storage and handling conditions to maintain protein integrity. The protein is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt . For proper reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Aliquot for long-term storage at -20°C or -80°C

For working solutions, avoid repeated freeze-thaw cycles as they can compromise protein integrity. Working aliquots can be stored at 4°C for up to one week . These storage conditions are critical for maintaining protein stability and ensuring experimental reproducibility.

What expression systems are most effective for producing functional recombinant BRP44?

E. coli is commonly used as an expression system for recombinant Bovine BRP44, as demonstrated in commercial preparations . When designing expression protocols, researchers should consider:

  • Codon optimization for the expression host

  • Selection of appropriate fusion tags (His-tag is common)

  • Optimization of induction conditions (temperature, IPTG concentration)

  • Selection of suitable purification strategies

For functional studies, it's important to verify that the recombinant protein retains its native conformation and activity after purification. This can be assessed through activity assays measuring pyruvate transport or through structural characterization techniques. While E. coli provides good yields, mammalian expression systems might be considered for studies requiring post-translational modifications.

How can BRP44 be utilized in mitochondrial metabolism research models?

BRP44/MPC2 serves as a valuable research tool for investigating mitochondrial metabolism, particularly pyruvate transport and utilization. Methodological approaches include:

  • Using recombinant BRP44 in reconstituted liposome systems to study pyruvate transport kinetics

  • Employing isotope-labeled pyruvate to track metabolic flux in the presence of normal or modified BRP44

  • Creating cell models with tagged BRP44 to visualize mitochondrial distribution and dynamics

  • Developing in vitro assays to screen for compounds that modulate BRP44 activity

When designing experiments, researchers should consider that BRP44 functions as part of a complex with BRP44L/MPC1 . For comprehensive mitochondrial metabolism studies, both proteins may need to be expressed and studied together to recreate physiologically relevant conditions.

What role might BRP44 play in neurological injury and regeneration processes?

Studies on the related protein BRP44L (MPC1) have shown interesting expression patterns during neurological injury and repair. In Gekko japonicus, BRP44L expression increases in the spinal cord after tail amputation, reaching peak levels one week post-injury . This suggests involvement in neural regeneration processes.

For researchers investigating BRP44's potential role in neurological injury:

  • Time-course expression studies should be conducted to map BRP44 regulation during injury and recovery phases

  • Comparative analyses between regenerative and non-regenerative species may reveal functional differences

  • Cell-specific expression patterns should be determined using in situ hybridization

  • Functional studies using knockout/knockdown approaches can help determine necessity in regeneration

The ubiquitous expression pattern of BRP44L across major organs (brain, spinal cord, heart, liver, kidney) suggests fundamental biological roles that may extend to BRP44, warranting investigation in multiple tissue contexts.

What molecular interactions should be considered when studying BRP44 function?

When investigating BRP44 function, researchers should consider several molecular interactions:

  • Protein Complex Formation: BRP44 interacts with BRP44L/MPC1 to form the functional mitochondrial pyruvate carrier

  • Metal Ion Interactions: While specific data for BRP44 is limited, related proteins show modulation by metal ions. For example, calcium ions (Ca²⁺) stimulate NMT2 activity while manganese (Mn²⁺) and zinc (Zn²⁺) are inhibitory

  • Substrate Binding: Pyruvate binding and transport kinetics should be characterized under various conditions

  • Membrane Interactions: As a mitochondrial membrane protein, interactions with membrane lipids are critical

Experimental approaches to study these interactions include co-immunoprecipitation, surface plasmon resonance, isothermal titration calorimetry, and functional reconstitution in artificial membrane systems.

How can researchers address challenges in interpreting BRP44 expression data across different experimental models?

Interpreting BRP44 expression data across different models presents several challenges:

  • Cross-Species Comparisons: BRP44 shows 85-89% similarity between species at the amino acid level (based on BRP44L data) , requiring careful consideration when transferring findings between models

  • Tissue-Specific Expression: Expression patterns may vary by tissue type, necessitating tissue-specific normalization

  • Developmental Variations: Expression may change during development or under different physiological conditions

  • Technical Variations: Different detection methods (RT-PCR, Northern blotting, in situ hybridization) may yield varying results

To address these challenges, researchers should:

  • Use multiple detection methods for validation

  • Include appropriate housekeeping genes for normalization

  • Report detailed experimental conditions

  • Employ statistical approaches that account for biological variability

  • Consider absolute quantification methods when comparing across studies

What potential roles might BRP44/MPC2 play in mitochondrial disease pathophysiology?

Mutations in the MPC2 gene (encoding BRP44) cause an autosomal recessive disease with symptoms similar to mitochondrial pyruvate carrier deficiency (typically associated with MPC1 gene mutations) . The clinical manifestations include:

  • Early-onset neurological problems

  • Elevated lactate and pyruvate levels with normal lactate/pyruvate ratio

  • Lactic acidosis

  • Hypotonia

  • Cardiomegaly

  • Facial dysmorphia

Researchers investigating the role of BRP44 in disease pathophysiology should consider:

  • Generating cellular or animal models with specific MPC2 mutations identified in patients

  • Measuring mitochondrial function parameters (oxygen consumption, membrane potential)

  • Analyzing metabolic profiles using metabolomics approaches

  • Exploring potential therapeutic strategies targeting pyruvate metabolism

Understanding the mechanistic basis of these clinical manifestations provides insights into fundamental mitochondrial biology and potential therapeutic approaches.

How might recombinant BRP44 contribute to developing therapeutic approaches for mitochondrial disorders?

Recombinant BRP44 offers several potential applications in developing therapeutics for mitochondrial disorders:

  • Drug Screening Platform: Recombinant protein can be used in high-throughput screening assays to identify compounds that enhance pyruvate transport activity

  • Structure-Based Drug Design: Purified protein enables structural studies to guide rational design of modulators

  • Functional Characterization: Testing patient-specific mutations using recombinant proteins helps understand pathogenic mechanisms

  • Protein Replacement Strategies: Although challenging, exploring mitochondrial protein delivery systems using modified recombinant proteins

When designing such studies, researchers should consider that functional pyruvate transport requires both MPC1 and MPC2 proteins , so therapeutic approaches may need to address both components of the transport system.

What is the relationship between BRP44 and cellular metabolic reprogramming in response to stress?

An emerging research direction explores how BRP44/MPC2 might be involved in metabolic reprogramming during cellular stress. While direct evidence is limited, related findings with BRP44L in spinal cord injury models suggest potential involvement in stress response pathways . Researchers investigating this area should consider:

  • Profiling BRP44 expression under various stress conditions (oxidative, nutritional, hypoxic)

  • Analyzing pyruvate metabolism shifts during stress responses

  • Investigating post-translational modifications of BRP44 during stress

  • Exploring interactions between BRP44 and stress-responsive transcription factors

The ubiquitous expression pattern suggests BRP44 may have context-dependent roles across different tissues , warranting tissue-specific investigations of stress responses.

How can advanced protein engineering approaches be applied to create BRP44 variants with enhanced experimental utility?

Protein engineering offers opportunities to create BRP44 variants with enhanced experimental utility:

  • Fluorescent Fusion Constructs: Creating BRP44-fluorescent protein fusions that maintain functionality for live-cell imaging

  • Split-Protein Complementation: Designing BRP44 fragments for protein-protein interaction studies

  • Conformation-Sensitive Variants: Engineering BRP44 to report on conformational changes during transport

  • Substrate Specificity Modifications: Creating variants with altered substrate specificity for metabolic engineering

When designing such protein engineering approaches, researchers should carefully consider the impact of modifications on protein folding, mitochondrial targeting, and complex formation with BRP44L/MPC1. Validating the functionality of engineered variants against the native protein is essential for meaningful experimental applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.