Recombinant Bovine Brain protein 44-like protein (BRP44L)

Shipped with Ice Packs
In Stock

Description

Functional Role

BRP44L is essential for cellular metabolism:

  • Pyruvate Transport: Partners with MPC2 to shuttle pyruvate into mitochondria for oxidation via the tricarboxylic acid (TCA) cycle .

  • Metabolic Regulation: Modulates glucose utilization and lipid synthesis .

  • Disease Links: Mutations cause mitochondrial pyruvate carrier deficiency, associated with lactic acidosis, neurodevelopmental delays, and cardiomyopathy .

Recombinant Production

Recombinant BRP44L is typically expressed in heterologous systems:

Expression SystemApplicationsPurityCitation
E. coliAntibody validation, binding assays≥90%
HEK-293 CellsStructural studies, functional reconstitution>80%

Key Notes:

  • Human BRP44L (Q9Y5U8) is commonly used as a model due to high cross-species conservation (100% identity in mouse/rat) .

  • A 54-amino acid fragment (aa 1–54) is often employed as a control in immunoassays .

Research Applications

Recombinant BRP44L enables:

  • Antibody Development: Used to generate polyclonal antibodies for Western blotting and immunohistochemistry .

  • Drug Discovery: Serves as a target for insulin sensitizers (e.g., thiazolidinediones) that modulate mitochondrial pyruvate uptake .

  • Disease Modeling: Facilitates studies on heart failure and metabolic disorders. For example, reduced MPC1/MPC2 levels correlate with impaired cardiac function in humans .

Clinical and Experimental Insights

  • ELISA Kits: Commercial assays (e.g., MyBiosource MBS7247075) quantify MPC2/BRP44 in plasma, aiding heart failure diagnostics .

  • Knockdown Effects: Silencing BRP44L in mammalian cells reduces pyruvate-driven oxygen consumption by up to 60%, confirming its metabolic role .

  • Inhibitor Studies: UK5099 blocks pyruvate transport in wild-type BRP44L but not in the D118G mutant, highlighting residue-specific functionality .

Challenges and Gaps

  • Species-Specific Data: Bovine BRP44L sequences/studies are not explicitly detailed in current literature, necessitating extrapolation from other mammals.

  • Structural Resolution: Full 3D structures of the BRP44L-MPC2 complex remain unresolved, limiting mechanistic insights .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
MPC1; BRP44L; Mitochondrial pyruvate carrier 1; Brain protein 44-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-109
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
MPC1
Target Protein Sequence
AGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCC YSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIRHEMSKKASA
Uniprot No.

Target Background

Function
This protein mediates the uptake of pyruvate into mitochondria.
Database Links
Protein Families
Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is BRP44L and what are its alternative nomenclatures?

BRP44L (Brain protein 44-like protein) belongs to the UPF0041 family and is now also known as Mitochondrial Pyruvate Carrier 1 (MPC1) or SLC54A1. Other aliases include HSPC040, CGI-129, and MPYCD. The protein was initially identified before its function was elucidated, leading to multiple names across the literature. The gene encoding BRP44L is located on human chromosome 6q27 . To determine which nomenclature is most appropriate for your research, consider your field's conventions and the specific aspect of the protein you're investigating.

What is the molecular structure and characteristics of recombinant BRP44L?

Recombinant BRP44L is a 109 amino acid mitochondrial protein with a calculated molecular weight of approximately 14 kDa, though observed weight in SDS-PAGE is typically 18-20 kDa due to post-translational modifications . The protein is commonly expressed in E. coli systems for research purposes . When studying recombinant BRP44L, researchers should consider:

  • Expression system characteristics (prokaryotic vs. eukaryotic)

  • Presence of fusion tags (His, FLAG, etc.) that may affect structure or function

  • Proper folding validation through CD spectroscopy or other biophysical techniques

  • Storage conditions (-80°C with minimal freeze-thaw cycles)

How does BRP44L interact with MPC2 to form the functional mitochondrial pyruvate carrier?

BRP44L (MPC1) forms a heterodimeric complex with MPC2 (formerly known as BRP44) to create the functional mitochondrial pyruvate carrier. Both proteins are required for complex stability and function . The complex has an oligomeric structure of approximately 150 kDa in the inner mitochondrial membrane . Experimental approaches to study this interaction include:

  • Co-immunoprecipitation to verify physical interaction

  • Reconstitution studies in liposomes to confirm transport function

  • Genetic knockout/knockdown of either component to demonstrate dependence

  • Chemical inhibition studies using UK-5099, a specific inhibitor of the MPC complex

What are the optimal methods for detecting and quantifying BRP44L in tissue samples?

Multiple approaches can be used to detect and quantify BRP44L, depending on your experimental question:

  • Protein Detection:

    • Western blotting: Recommended antibody dilutions range from 1:500-1:2000

    • Immunofluorescence: Optimal dilutions range from 1:50-1:500

    • ELISA: Sandwich ELISA kits with detection ranges of 0.15-10 ng/mL are available

  • mRNA Detection:

    • RT-PCR using validated primers: Forward 5′-CGCGTTGGTGCGGAAAGCG-3′ and reverse 5′-GGCAAATGTCATCCGCCCACTGA-3′

    • qPCR with SYBR-based quantification using the 2^-ΔΔCq method

When selecting a method, consider sample type (tissue homogenate, cell lysate, etc.), required sensitivity, and whether you need to assess spatial distribution versus total expression levels.

What expression systems are most effective for producing functional recombinant BRP44L?

E. coli expression systems are commonly used for recombinant BRP44L production, but functional considerations should guide your system selection:

  • E. coli systems: Provide high yield but may lack post-translational modifications

  • Mammalian expression systems: Provide more native-like modifications but lower yield

  • Yeast systems: Offer a compromise between yield and eukaryotic processing

For functional studies, co-expression with MPC2 may be necessary since BRP44L/MPC1 alone does not form a functional transporter. Validation of proper folding is essential regardless of the expression system chosen.

How can CRISPR-based technologies be applied to study BRP44L function?

CRISPR technologies offer powerful approaches for studying BRP44L function:

  • CRISPR knockout: Generate MPC1 null cells/animals to study metabolic consequences

  • CRISPR activation (CRISPRa): Systems like the synergistic activation mediator (SAM) can enhance BRP44L expression

  • CRISPR interference (CRISPRi): Repress BRP44L expression without complete knockout

  • CRISPR knock-in: Introduce tagged versions or disease-specific mutations

A typical CRISPRa system for BRP44L includes:

  • deactivated Cas9 (dCas9) fused to VP64 activation domain

  • sgRNA with MS2 binding loops

  • MS2-P65-HSF1 fusion protein for enhanced activation

This approach enables precise modulation of BRP44L levels to study dose-dependent effects on pyruvate metabolism.

What is the role of BRP44L in mitochondrial pyruvate transport?

BRP44L/MPC1 forms an essential complex with MPC2 to transport pyruvate across the inner mitochondrial membrane, representing a critical link between cytosolic glycolysis and mitochondrial oxidative phosphorylation . The transport mechanism likely involves:

  • A proton symport system where pyruvate movement is coupled to proton translocation

  • Saturation kinetics characteristic of carrier-mediated transport

  • Specific inhibition by the compound UK-5099

Functionally, this transport is crucial for:

  • Providing substrate for the TCA cycle

  • Enabling gluconeogenesis from pyruvate in tissues like liver

  • Supporting lactate metabolism

  • Regulating the cellular redox state

How does BRP44L/MPC1 deficiency affect cellular metabolism?

BRP44L/MPC1 deficiency profoundly alters cellular metabolism by blocking pyruvate entry into mitochondria:

  • Metabolic shifts:

    • Increased lactate production and acidosis

    • Reduced mitochondrial oxygen consumption

    • Metabolite changes including decreased citrate and increased alanine levels

    • Increased glutamine utilization with reduced total glutamate and increased aspartate

  • Cellular adaptations:

    • Enhanced anaerobic glycolysis

    • Altered amino acid metabolism

    • Changes in lipid metabolism

    • Potential compensatory use of alternative substrates

These changes resemble aspects of the Warburg effect observed in cancer cells, making BRP44L/MPC1 a potential target for metabolic intervention strategies.

What experimental approaches can be used to measure BRP44L-mediated pyruvate transport activity?

Several methodologies can assess BRP44L-mediated pyruvate transport:

  • Isolated mitochondria assays:

    • Measuring [14C]-pyruvate uptake in isolated mitochondria

    • Using membrane potential-sensitive dyes to monitor associated changes

    • Comparing transport rates with/without specific inhibitor UK-5099

  • Cellular metabolic assays:

    • Seahorse XF analyzer to measure oxygen consumption rate (OCR) with pyruvate as substrate

    • Lactate production measurements before/after manipulation of BRP44L levels

    • Isotope tracing experiments with 13C-labeled pyruvate to track metabolic fates

  • Reconstituted systems:

    • Proteoliposomes containing recombinant BRP44L/MPC1 and MPC2

    • Bacterial expression systems engineered to express the MPC complex

What is the evidence linking BRP44L dysfunction to human diseases?

BRP44L/MPC1 dysfunction has been implicated in several pathological conditions:

  • Mitochondrial Pyruvate Carrier Deficiency (MPYCD):

    • Autosomal recessive disease caused by mutations in the MPC1 gene

    • Characterized by lactic acidosis, hypoglycemia, neurological problems, and hypotonia

    • Exhibits biochemical pattern of normal lactate/pyruvate ratio, but elevated levels of both

  • Cancer:

    • Reduced MPC1 expression is common across multiple cancer types

    • Associated with poorer prognosis in hepatocellular carcinoma (HCC)

    • May contribute to the Warburg effect by limiting mitochondrial pyruvate utilization

  • Neurological conditions:

    • Potential role in neuroprotection pathways

    • May influence neuronal metabolism and survival

The following table summarizes key associations between MPC1/BRP44L expression and clinical outcomes in HCC:

VariablesHazard Ratio (95% CI)P-value
MPC1 expression (low/high)3.926 (2.205–6.989)<0.001
Microvascular invasion2.115 (1.143–3.913)0.017
BCLC stage (0-A/B-C)1.288 (0.657–3.622)0.461
Tumor size (>5/≤5 cm)0.697 (0.369–1.315)0.264

Data adapted from multivariate analysis of recurrence-free survival in HCC patients

How might BRP44L function contribute to neuroprotection?

BRP44L/MPC1 may play a significant role in neuroprotection through several mechanisms:

  • Metabolic regulation:

    • Maintaining energy production through efficient pyruvate utilization

    • Reducing lactate accumulation and associated acidosis

    • Supporting glutamate-glutamine cycling in neural tissues

  • Oxidative stress management:

    • Influencing redox balance through regulation of pyruvate entry into mitochondria

    • Potentially affecting ROS production from mitochondrial metabolism

  • Evidence from research:

    • Inhibition of MPC has been studied as a neuroprotective strategy

    • Changes in metabolite profiles (reduced glutamate, increased aspartate) may influence excitotoxicity

    • Potential role in surviving myocardium after ischemia/reperfusion suggests generalized cytoprotective functions

Future therapeutic approaches may target BRP44L/MPC activity to modulate these neuroprotective mechanisms.

What is the role of BRP44L in cancer metabolism and how might it be targeted therapeutically?

BRP44L/MPC1 has emerged as a significant factor in cancer metabolism and potential therapeutic target:

  • Cancer metabolic phenotype:

    • Reduced MPC1 expression is common across multiple cancer types

    • Low MPC1 levels correlate with poor prognosis in hepatocellular carcinoma

    • May contribute to the Warburg effect by limiting pyruvate entry into mitochondria

  • Regulatory significance:

    • Acts as a critical control point between glycolysis and oxidative phosphorylation

    • MPC1 depletion forces cancer cells to rely more heavily on glutamine metabolism

    • May influence metabolic plasticity of tumor cells

  • Therapeutic approaches:

    • MPC activators could potentially reverse the Warburg effect

    • MPC inhibitors might be useful in contexts where mitochondrial metabolism drives tumor growth

    • Combination with drugs targeting glutamine metabolism could exploit metabolic vulnerabilities

Advanced research should focus on tissue-specific effects of MPC modulation and potential synergies with existing anti-cancer therapies.

How do post-translational modifications regulate BRP44L function?

Post-translational modifications (PTMs) of BRP44L/MPC1 represent an emerging area of research:

  • Observed modifications:

    • The discrepancy between calculated (14 kDa) and observed (18-20 kDa) molecular weights suggests significant PTMs

    • Potential phosphorylation, acetylation, or ubiquitination sites have been predicted

  • Functional implications:

    • PTMs may regulate complex assembly with MPC2

    • Activity modulation in response to metabolic state

    • Alterations in protein stability or subcellular localization

  • Methodological approaches:

    • Mass spectrometry to identify specific PTM sites

    • Site-directed mutagenesis to assess functional impact

    • Phosphoproteomic analysis under various metabolic conditions

    • In vitro enzymatic assays to identify regulatory enzymes

This area remains underdeveloped but could reveal important dynamic regulation of mitochondrial pyruvate transport.

What are the structure-function relationships in BRP44L that determine pyruvate transport specificity?

Understanding the structure-function relationships in BRP44L/MPC1 is crucial for elucidating transport mechanisms:

  • Structural features:

    • BRP44L belongs to the UPF0041 family

    • Forms a heterodimeric complex with MPC2 of approximately 150 kDa

    • Contains transmembrane domains for integration into the inner mitochondrial membrane

  • Functional domains:

    • Specific residues involved in pyruvate binding

    • Regions mediating interaction with MPC2

    • Domains involved in proton coupling

  • Advanced methodologies:

    • Cryo-EM or X-ray crystallography to determine complex structure

    • Molecular dynamics simulations to model transport mechanism

    • Functional reconstitution with site-specific mutations

    • Crosslinking studies to map interaction interfaces

Progress in this area could facilitate rational design of modulators with therapeutic potential.

How does the BRP44L/MPC complex interact with other mitochondrial carriers and metabolic enzymes?

The integration of BRP44L/MPC1 function with other mitochondrial systems represents a frontier in research:

  • Potential interacting partners:

    • Pyruvate dehydrogenase complex (PDH)

    • Mitochondrial carrier family members

    • Components of the electron transport chain

    • Mitochondrial quality control machinery

  • Functional coordination:

    • Metabolic channeling between pyruvate transport and oxidation

    • Coordinated regulation with other substrate transporters

    • Integration with mitochondrial dynamics and biogenesis

  • Experimental approaches:

    • Proximity labeling techniques (BioID, APEX)

    • Co-immunoprecipitation followed by mass spectrometry

    • Blue native PAGE to identify stable complexes

    • Dynamic fluorescence techniques to monitor interactions in living cells

This systems-level understanding could reveal how BRP44L/MPC1 function is integrated into broader metabolic networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.