Recombinant Bovine C-X-C chemokine receptor type 4 (CXCR4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine C-X-C Chemokine Receptor Type 4 (CXCR4)

CXCR4 is a G protein-coupled receptor (GPCR) with a conserved seven-transmembrane (7TM) structure, critical for regulating cell migration, survival, and proliferation via interactions with its ligand CXCL12 (SDF-1α) . Recombinant bovine CXCR4 refers to the engineered form of this receptor produced in heterologous expression systems (e.g., CHO cells) for functional and structural studies. While bovine-specific CXCR4 research is limited, insights from human and model systems highlight its roles in cancer metastasis, HIV entry, and hematopoietic stem cell trafficking .

Expression Systems for Recombinant CXCR4

Recombinant CXCR4 is commonly expressed in CHO cells for stability and scalability. For example:

Cell LineExpression Level (Molecules/Cell)Adaptability to Suspension Culture
INS-SF-1004-L~400No
INS-SF1004-MH~9,500Yes

Data sourced from CHO-CXCR4 cell lines .

These systems enable studies on receptor trafficking, ligand binding, and downstream signaling .

Cancer Metastasis

CXCR4 overexpression in tumors (e.g., breast, prostate) promotes metastasis via:

  • Angiogenesis: Activation of RAS-MAPK and PI3K-AKT pathways .

  • Cell-cycle dysregulation: Increased G1 phase arrest in MDA-MB-231 cells treated with recombinant P21 (rP21), a CXCR4-binding protein .

  • Receptor internalization: rP21 induces CXCR4 downregulation and desensitization in triple-negative breast cancer cells (Fig. 2) .

HIV Entry

CXCR4 acts as a co-receptor for X4-tropic HIV-1 strains. Key interactions include:

  • gp120 binding: Facilitates viral fusion with host cells .

  • Antibody targeting: Engineered bovine-human chimeric antibodies (e.g., bAb-AC1) block CXCR4-HIV interactions with >65% binding efficacy .

Hematopoietic Trafficking

CXCR4 regulates bone marrow homing of T cells and B-1a lymphocytes, influencing immune responses and atherosclerosis risk .

Key Studies on CXCR4 Modulation

  • rP21 in breast cancer: Reduces MDA-MB-231 invasion by 51–53% via CXCR4 internalization and G1 phase arrest .

  • CXCR4 antagonists: AMD3100 (Plerixafor) mobilizes hematopoietic stem cells and sensitizes tumors to chemotherapy .

  • Bovine-derived antibodies: Anti-CXCR4 antibodies with elongated CDRH3 domains show promise in blocking HIV entry (Fig. 3) .

Clinical Correlations

  • WHIM syndrome: CXCR4 mutations cause warts, hypogammaglobulinemia, and myelokathexis .

  • Atheroprotection: CXCR4+ B-1 cells correlate with higher anti-inflammatory IgM and reduced coronary plaque burden .

Challenges and Future Directions

While recombinant CXCR4 studies have advanced cancer and HIV therapeutics, challenges remain:

  • Species-specific limitations: Most data derive from human/murine models, with limited bovine CXCR4 characterization .

  • Structural plasticity: Variability in ligand-binding pockets complicates drug design .

  • Dual receptor targeting: Simultaneous modulation of CXCR4 and ACKR3 (atypical chemokine receptor 3) may enhance therapeutic efficacy .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize development according to your specifications.
Synonyms
CXCR4; C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; Fusin; LCR1; Leukocyte-derived seven transmembrane domain receptor; LESTR; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD antigen CD184
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MEGIRIFTSDNYTEDDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLV ILVMGYQKKLRSMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGKFLCKAVHVIYTVN LYSSVLILAFISLDRYLAIVHATNSQKPRKLLAEKVVYVGVWLPAVLLTIPDLIFADIKE VDERYICDRFYPSDLWLVVFQFQHIVVGLLLPGIVILSCYCIIISKLSHSKGYQKRKALK TTVILILTFFACWLPYYIGISIDSFILLEIIQQGCEFESTVHKWISITEALAFFHCCLNP ILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Uniprot No.

Target Background

Function
CXCR4, the receptor for the chemokine CXCL12/SDF-1, transduces signals by elevating intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. It is involved in the AKT signaling cascade and plays a crucial role in regulating cell migration, as seen during wound healing. CXCR4 acts as a receptor for extracellular ubiquitin, leading to increased intracellular calcium ions and reduced cellular cAMP levels. It binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. CXCR4 is essential for hematopoiesis and cardiac ventricular septum formation. It plays a vital role in vascularization of the gastrointestinal tract, likely by regulating vascular branching and/or remodeling processes in endothelial cells. Additionally, CXCR4 is involved in cerebellar development. In the central nervous system, it may mediate hippocampal-neuron survival.
Gene References Into Functions
  1. An analysis failed to identify a causal mutation on the CXCR4 gene underlying a previously reported quantitative trait loci for cattle trypanotolerance on bovine chromosome 2. PMID: 27117936
  2. There is a potential link between follicular SDF1/CXCR4 activation and the regulation of ovulation-related genes in cows and horses. PMID: 24784705
  3. The combination of low CXCR4 expression and high IL-10 expression might be closely associated with a bias for the production of PI calves. PMID: 24059096
Database Links

KEGG: bta:281736

STRING: 9913.ENSBTAP00000001406

UniGene: Bt.8957

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome.
Tissue Specificity
Brain, heart, kidney, lung and liver.

Q&A

What is the basic structure and function of bovine CXCR4?

Bovine CXCR4, like its human counterpart, is a G-protein-coupled receptor with seven transmembrane domains that primarily binds to stromal cell-derived factor 1 (SDF-1, also known as CXCL12). The receptor mediates chemotaxis of various cell types including immune cells, stem cells, and progenitor cells. CXCR4 signaling activates multiple downstream pathways including MAPK, PI3K/Akt, and JAK/STAT, which regulate cellular processes such as migration, adhesion, proliferation, and survival.

The structure of bovine CXCR4 shares significant homology with human CXCR4, which functions as a co-receptor in HIV infection and plays crucial roles in embryonic development, tissue homeostasis, and immune surveillance . Unlike some other chemokine receptors, CXCR4 expression is not limited to specific cell types but is found across multiple tissues, with particularly important roles in hematopoietic stem cell trafficking and embryonic development.

How does bovine CXCR4 expression vary across different tissues?

Bovine CXCR4 expression follows tissue-specific patterns similar to those observed in other mammalian species. The receptor is prominently expressed in immune cells, particularly in lymphocytes and monocytes. In bovine reproductive tissues, CXCR4 plays important roles in follicular development and corpus luteum function.

Expression levels vary significantly between tissue types, with hematopoietic cells generally showing higher surface expression compared to epithelial tissues. This differential expression pattern is critical for tissue-specific functions, including directed cell migration during inflammation and development. The expression patterns of CXCR4 in bovine tissues can be analyzed using flow cytometry with specific antibodies to quantify surface expression, similar to the methods used for human CXCR4 quantification .

What are the most effective systems for recombinant expression of bovine CXCR4?

For recombinant expression of bovine CXCR4, several mammalian expression systems have proven effective, with CHO cells being particularly suitable for stable expression. When designing expression constructs, researchers should consider:

  • Vector selection: Vectors with strong promoters (CMV) optimize expression levels

  • Signal peptide: Inclusion of an appropriate signal peptide ensures proper membrane localization

  • Purification tags: C-terminal tags are preferable to N-terminal modifications that might interfere with ligand binding

  • Selection markers: Neomycin resistance genes allow for stable cell line generation

For example, a CXCR4 expression vector controlled by a cytomegalovirus (CMV) immediate-early enhancer/promoter can be constructed between transposon elements to facilitate stable integration, as demonstrated with chicken CXCR4 . After transfection, stable CXCR4-expressing cell lines can be selected using neomycin resistance. Expression levels can be further optimized through single-cell cloning to identify high-expressing clones.

CHO-K1 cells represent an ideal backbone for bovine CXCR4 expression due to their capacity for proper post-translational modifications and trafficking of membrane proteins . These cells can be engineered to express defined levels of CXCR4, from low (approximately 400 molecules/cell) to medium-high (approximately 9,500 molecules/cell) as measured by quantitative flow cytometry methods like Quantibrite .

How can I verify the functional expression of recombinant bovine CXCR4?

Verifying functional expression of recombinant bovine CXCR4 requires multiple complementary approaches:

Surface Expression Verification:

  • Flow cytometry using CXCR4-specific antibodies to quantify receptor density

  • Immunofluorescence microscopy to confirm membrane localization

  • Western blotting of membrane fractions to verify protein size

Functional Verification:

  • Calcium flux assays following SDF-1 stimulation

  • Migration assays to confirm chemotactic response

  • Binding assays with labeled SDF-1 or receptor antagonists

  • Signaling assays measuring downstream pathway activation (ERK phosphorylation)

It's important to note that transcript or whole-cell protein-level analysis does not necessarily represent CXCR4 expression on the cell surface . Surface expression is the key parameter for successful CXCR4-directed applications, both for diagnostic imaging and therapeutic approaches. Researchers should therefore prioritize methods that specifically measure surface-expressed CXCR4, such as flow cytometry with non-permeabilized cells.

What approaches are most effective for CXCR4 knockout in bovine cell models?

CRISPR-Cas9 genome editing represents the most efficient approach for generating CXCR4 knockout in bovine cell models. Based on protocols developed for other species, the following methodology can be adapted for bovine cells:

  • Design multiple guide RNAs (gRNAs) targeting conserved regions of the bovine CXCR4 gene, preferably in early exons to ensure complete functional disruption

  • Co-transfect a gRNA expression vector with a Cas9 expression vector carrying a fluorescent reporter gene

  • Enrich for transfected cells using fluorescence-activated cell sorting (FACS)

  • Generate single-cell-derived sublines to obtain homogeneous knockout populations

  • Validate knockout through genomic PCR, sequencing, and functional assays

For effective targeting, gRNAs should be designed to induce frameshift mutations that result in premature termination codons. In a similar approach used for chicken PGCs, a gRNA targeting the second exon of CXCR4 successfully created a frameshift mutation through a 2-nucleotide deletion . After enrichment of transfected cells, single-cell isolation and expansion enables the generation of clonal knockout lines.

Validation of knockout should include genomic analysis through PCR amplification of the targeted region and sequencing to confirm mutations, as well as functional assays to confirm loss of receptor activity. RT-PCR, immunoblotting, and flow cytometry should be used to verify absence of CXCR4 expression at mRNA, protein, and cell surface levels, respectively .

How can I create cell models with controlled levels of bovine CXCR4 expression?

Creating cell models with controlled levels of bovine CXCR4 expression requires precise regulation of gene expression. Several approaches can be implemented:

For Stable Expression Systems:

  • Use promoters of varying strengths to control expression levels

  • Implement inducible expression systems (tetracycline-regulated)

  • Generate and screen multiple clones to select those with desired expression levels

  • Employ site-specific integration systems for reproducible expression

For Transient Expression Systems:

  • Titrate plasmid concentrations during transfection

  • Optimize transfection conditions for consistency

  • Use fluorescent reporter co-expression to normalize for transfection efficiency

Quantitative assessment of expression levels is essential, with flow cytometry using calibration beads (e.g., Quantibrite) providing the most reliable measure of surface receptor density. This approach can determine absolute receptor numbers per cell, as demonstrated with CHO-CXCR4 cell lines expressing human CXCR4 at different levels (400 versus 9,500 molecules/cell) .

When designing such systems, researchers should consider that different expression levels may be required for different experimental applications. For binding studies, lower expression levels that mimic physiological conditions may be preferable, while higher expression might be necessary for functional assays with lower sensitivity.

What are the most informative functional assays for studying bovine CXCR4?

Several functional assays provide valuable insights into bovine CXCR4 biology:

Migration Assays:
Transwell migration assays represent the gold standard for assessing CXCR4 function. Cells expressing bovine CXCR4 are placed in the upper chamber, with SDF-1/CXCL12 in the lower chamber. Quantification of migrated cells directly measures receptor functionality. This approach can be used to study both chemotaxis (directional migration) and chemokinesis (random migration).

Calcium Flux Assays:
CXCR4 activation triggers calcium release from intracellular stores. Using calcium-sensitive fluorescent dyes (Fluo-4, Fura-2), researchers can measure real-time signaling following ligand stimulation. These assays are particularly useful for screening antagonists or comparing signaling efficiency between mutants.

Internalization Assays:
Following agonist binding, CXCR4 undergoes internalization. Flow cytometry or immunofluorescence microscopy can track this process by measuring surface receptor levels before and after ligand exposure. This provides insights into receptor trafficking and desensitization mechanisms.

Cell Adhesion Assays:
CXCR4 signaling modulates cellular adhesion properties. Adhesion assays to relevant substrates (fibronectin, VCAM-1) can measure these effects. Loss of CXCR4 has been shown to promote loss of cell adhesion in some contexts , making this a relevant functional readout.

Signaling Assays:
Western blotting for phosphorylated ERK1/2, Akt, or other downstream effectors provides direct evidence of signaling pathway activation. This can be complemented with luciferase reporter assays for transcriptional responses, such as those mediated by CREB or NF-κB.

How can bovine CXCR4 be effectively used in migration studies?

Migration studies using bovine CXCR4 require careful experimental design:

  • Cell Selection:
    Choose appropriate cellular backgrounds with minimal endogenous chemokine receptor expression to avoid confounding results. Primary bovine cells or transfected cell lines with confirmed CXCR4 expression should be used.

  • Assay Format:
    Transwell chambers with appropriate pore sizes (5-8 μm) allow for quantitative assessment of migration. Both endpoint and real-time migration systems can be employed.

  • Controls:
    Include essential controls:

    • CXCR4 antagonist controls (AMD3100)

    • Cells lacking CXCR4 expression

    • Chemokinesis controls (equal chemokine concentration in both chambers)

    • Positive migration controls (serum or growth factors)

  • Gradient Optimization:
    Test multiple SDF-1 concentrations (1-300 ng/ml) to determine optimal migration response, as both insufficient and excessive ligand concentrations can reduce migration efficiency.

  • Quantification Methods:

    • Cell counting (hemocytometer or automated cell counter)

    • Crystal violet staining of migrated cells

    • Fluorescent labeling for flow cytometry analysis

    • Real-time cell analysis systems for kinetic measurements

Studies of primordial germ cell migration in chickens demonstrated the essential role of CXCR4 in directed cell migration, with CXCR4 knockout significantly reducing migratory capacity in vivo . These approaches can be adapted for studying bovine CXCR4 in various contexts including immune cell trafficking, stem cell homing, and developmental processes.

What is the role of CXCR4 in renal disease models and how can bovine models contribute to this research?

CXCR4 plays a significant role in renal disease pathogenesis, particularly in podocyte injury and glomerulosclerosis. In mouse models of adriamycin nephropathy (ADR), CXCR4 expression is significantly induced in podocytes as early as 3 days after injury . This upregulation coincides with increased oxidative stress markers, including malondialdehyde, nitrotyrosine, and secretion of 8-hydroxy-2′-deoxyguanosine in urine .

Mechanistically, CXCR4 induction is dependent on NADPH oxidase activation, ERK signaling, and p65 activation. Increased CXCR4 expression contributes to podocyte dysfunction, proteinuria, and renal fibrosis through:

  • Exacerbation of oxidative stress via NADPH oxidase upregulation

  • Loss of podocyte-specific markers (WT1, nephrin, podocalyxin)

  • Upregulation of injury markers like desmin

  • Promotion of inflammatory signaling cascades

Bovine models can contribute valuable insights to this research domain due to similarities in kidney structure and pathophysiology between bovines and humans. Bovine CXCR4 studies could help:

  • Validate findings from murine models in a larger mammalian system

  • Investigate species-specific differences in CXCR4 signaling

  • Develop therapeutic approaches targeting the CXCR4/SDF-1 axis in renal disease

The table below summarizes key findings on CXCR4 in renal disease models that could guide bovine CXCR4 research:

ParameterObservation in Disease ModelsPotential Therapeutic Implication
CXCR4 expressionUpregulated in podocytes after injuryTargeted inhibition may protect podocytes
Oxidative stressCXCR4 expression correlates with increased markers (NOX2, NOX4)Antioxidants may reduce CXCR4-mediated damage
Podocyte markersDecreased WT1, nephrin, podocalyxin with CXCR4 inductionCXCR4 antagonism may preserve podocyte function
Fibrosis markersIncreased following CXCR4 activationCXCR4 blockade may reduce renal fibrosis

How can recombinant bovine CXCR4 contribute to research on cancer metastasis?

Recombinant bovine CXCR4 systems can serve as valuable models for studying fundamental mechanisms of cancer metastasis. The CXCR4/SDF-1 axis is implicated in multiple aspects of tumor biology, including:

  • Directed migration of tumor cells toward SDF-1-rich metastatic niches

  • Enhanced survival and proliferation of disseminated tumor cells

  • Modulation of the tumor microenvironment through recruitment of supportive cell populations

  • Resistance to conventional therapies through activation of pro-survival signaling

While human CXCR4 has been extensively studied in cancer contexts, comparative studies using bovine CXCR4 can provide insights into conserved versus species-specific aspects of CXCR4 function. Studies of human CXCR4 in cervical cancer have shown variable expression patterns, with downregulation observed in 51% of tumor biopsies , contrasting with upregulation reported in other cancer types. This suggests context-dependent roles that warrant further investigation.

Researchers can use bovine CXCR4 models to:

  • Identify conserved regulatory mechanisms governing CXCR4 expression

  • Test the efficacy of CXCR4 antagonists across species to identify broadly effective compounds

  • Investigate species-specific differences in downstream signaling pathways

  • Develop novel imaging approaches for detecting CXCR4-expressing tissues

Such comparative approaches may reveal evolutionary conserved mechanisms that represent fundamental aspects of CXCR4 biology and therefore more promising therapeutic targets.

What are the current methods for imaging and detecting bovine CXCR4 expression in tissues?

Several imaging methods can be adapted from human studies for detecting bovine CXCR4:

Immunohistochemistry (IHC):
IHC remains the gold standard for tissue-level detection of CXCR4. When applying this technique to bovine tissues, researchers should:

  • Validate antibody cross-reactivity with bovine CXCR4

  • Optimize antigen retrieval methods for formalin-fixed tissues

  • Include appropriate positive and negative control tissues

  • Consider dual staining with cell-type markers to identify specific CXCR4-expressing populations

IHC has been successfully used to detect CXCR4 in various tissues, revealing upregulation in pathological conditions such as tumors and inflammatory sites .

PET Imaging with Radiolabeled Ligands:
Advanced molecular imaging of CXCR4 can be performed using positron emission tomography (PET) with specific radiolabeled ligands. [68Ga]Pentixafor is a high-affinity CXCR4-targeted probe that has shown excellent specificity and contrast in human studies . While this probe has high selectivity for human CXCR4, modified versions could potentially be developed for bovine applications.

The development of PET imaging ligands for bovine CXCR4 would require:

  • Evaluation of cross-reactivity of existing human CXCR4 probes with bovine CXCR4

  • Modification of probe structures to optimize binding to bovine CXCR4

  • Validation in recombinant cell systems expressing bovine CXCR4

  • Pilot studies in bovine models to assess biodistribution and specificity

Flow Cytometry:
For cellular detection, flow cytometry provides quantitative assessment of surface CXCR4 expression. This approach allows precise quantification of receptor density using calibration standards, as demonstrated with human CXCR4 expression in CHO cells (400-9,500 molecules/cell) .

How can I develop bovine-specific probes for CXCR4 imaging?

Developing bovine-specific probes for CXCR4 imaging requires a systematic approach:

  • Sequence Analysis and Homology Modeling:

    • Compare bovine and human CXCR4 sequences to identify conserved and divergent regions

    • Create homology models of bovine CXCR4 based on human crystal structures

    • Use in silico docking to predict binding sites for potential probes

  • Peptide Library Screening:

    • Generate peptide libraries based on SDF-1 or known CXCR4-binding motifs

    • Screen for bovine CXCR4 binding using cell lines expressing the receptor

    • Optimize lead candidates for specificity and affinity

  • Probe Development:

    • Conjugate selected peptides with appropriate imaging tags:

      • Fluorescent dyes for microscopy and flow cytometry

      • Radioisotopes (68Ga, 64Cu) for PET imaging

      • MRI contrast agents for anatomical imaging

  • Validation:

    • Confirm specific binding using competition assays

    • Demonstrate species selectivity using human vs. bovine CXCR4

    • Assess biodistribution in normal tissues

    • Evaluate signal-to-background ratios in relevant disease models

The development of [68Ga]Pentixafor for human CXCR4 imaging provides a valuable template for this process . This PET tracer demonstrated high specificity and contrast in detecting CXCR4-expressing tissues, with tracer accumulation correlating with CXCR4 cell surface expression. Similar approaches could be applied to develop bovine-specific imaging agents, potentially starting with modifications to the Pentixafor scaffold to enhance affinity for bovine CXCR4.

How is bovine CXCR4 expression regulated at transcriptional and post-transcriptional levels?

Bovine CXCR4 expression regulation likely shares key mechanisms with other mammalian systems:

Transcriptional Regulation:

  • Promoter Elements: The CXCR4 promoter contains binding sites for multiple transcription factors including NF-κB, HIF-1α, and Sp1

  • Hypoxia Induction: Hypoxic conditions strongly upregulate CXCR4 through HIF-1α binding to hypoxia response elements

  • Inflammatory Signaling: Cytokines like TNF-α and IL-1β can modulate CXCR4 expression through NF-κB activation

  • Growth Factor Signaling: VEGF and other growth factors can increase CXCR4 expression in various cell types

Epigenetic Regulation:
CXCR4 expression is subject to epigenetic control through:

  • DNA Methylation: Hypermethylation of the CXCR4 promoter leads to transcriptional silencing in some contexts

  • Histone Modifications: Histone acetylation and methylation patterns influence chromatin accessibility at the CXCR4 locus

  • miRNA Regulation: Multiple miRNAs target CXCR4 mRNA, including miR-126, miR-146a, and miR-150

Studies of cervical cancer cells have demonstrated that epigenetic silencing of CXCR4 occurs in approximately 51% of tumor biopsies , suggesting that epigenetic mechanisms play a significant role in regulating this receptor. Similar regulatory mechanisms likely apply to bovine CXCR4, though species-specific differences may exist in the exact transcription factor binding sites and miRNA target sequences.

Post-translational Regulation:
At the protein level, CXCR4 expression is regulated by:

  • Receptor Internalization: Ligand-induced endocytosis followed by recycling or degradation

  • Ubiquitination: Targeting for proteasomal or lysosomal degradation

  • Glycosylation: N-linked glycosylation affecting receptor stability and trafficking

  • Sulfation: Tyrosine sulfation influencing ligand binding properties

What are the key signaling pathways downstream of bovine CXCR4 and how can they be studied?

Bovine CXCR4 likely activates similar downstream pathways as its human counterpart:

Major Signaling Pathways:

  • G-protein Dependent Pathways:

    • Gαi-mediated inhibition of adenylyl cyclase

    • Gβγ-triggered phospholipase C activation and calcium mobilization

    • PI3K/Akt pathway activation promoting cell survival

    • MAPK pathway (ERK1/2) stimulation driving proliferation

  • G-protein Independent Pathways:

    • β-arrestin recruitment leading to receptor internalization

    • JAK/STAT pathway activation influencing gene expression

    • Src family kinase activation affecting cytoskeletal rearrangement

Methods for Studying These Pathways:

  • G-protein Coupling:

    • GTPγS binding assays to measure G-protein activation

    • cAMP accumulation assays to assess Gαi function

    • BRET-based sensors for real-time monitoring of G-protein coupling

  • Calcium Signaling:

    • Fluorescent calcium indicators (Fluo-4, Fura-2) for real-time imaging

    • Plate-based fluorometric assays for high-throughput screening

    • Calcium-dependent transcriptional reporters (NFAT-luciferase)

  • MAPK Pathway:

    • Western blotting for phosphorylated ERK1/2

    • ERK-dependent transcriptional reporters

    • Pharmacological inhibitors to dissect pathway components

  • PI3K/Akt Pathway:

    • Western blotting for phosphorylated Akt

    • PIP3 reporters for direct measurement of PI3K activity

    • Downstream substrate phosphorylation (GSK3β, FOXO)

  • β-arrestin Recruitment:

    • BRET/FRET-based recruitment assays

    • Immunofluorescence for arrestin translocation

    • Functional assays for arrestin-dependent vs. G-protein-dependent signaling

Studies of CXCR4 in renal disease models have shown activation of NADPH oxidase, ERK, and p65 , suggesting these are conserved downstream pathways that likely apply to bovine CXCR4 as well. These pathways contribute to oxidative stress and tissue damage in pathological conditions, highlighting potential therapeutic targets.

How does bovine CXCR4 compare structurally and functionally to human and other mammalian CXCR4 proteins?

Bovine CXCR4 shares significant structural and functional homology with human and other mammalian CXCR4 proteins:

Structural Comparison:

  • Sequence Homology: Bovine CXCR4 typically shares ~90% amino acid identity with human CXCR4, with most differences occurring in the N-terminal domain and extracellular loops

  • Conserved Domains: The seven transmembrane domains and intracellular DRY motif crucial for G-protein coupling are highly conserved across species

  • Binding Pocket: Residues forming the ligand-binding pocket are largely conserved, explaining cross-species activity of many CXCR4 antagonists

  • Post-translational Modification Sites: Many glycosylation and sulfation sites are conserved, though species-specific differences exist

Functional Comparison:

  • Ligand Binding: Both bovine and human CXCR4 bind SDF-1/CXCL12 with high affinity

  • Signaling Pathways: Core signaling mechanisms through Gαi and β-arrestin are conserved

  • Developmental Functions: CXCR4 plays similar roles in embryonic development across mammalian species

  • Immune Functions: Regulation of immune cell trafficking and homing is conserved

A comprehensive comparison of CXCR4 across species would help identify both conserved domains that are essential for function and divergent regions that might be targeted for species-specific applications. This is particularly relevant for developing bovine-specific imaging probes or therapeutic agents, as demonstrated by the observation that [68Ga]Pentixafor binds selectively to human CXCR4 but not murine CXCR4 .

What can we learn from comparing bovine CXCR4 with CXCR4 from other species in research applications?

Comparative studies of CXCR4 across species offer valuable insights:

  • Evolutionary Conservation:
    Highly conserved regions likely represent functionally critical domains that have been maintained through evolutionary pressure. These regions may be essential for core functions like ligand binding or G-protein coupling.

  • Species-Specific Adaptations:
    Divergent regions may reflect adaptations to species-specific physiological requirements or pathogen pressures. For example, differences in the N-terminal domain might affect interaction with species-specific pathogens that utilize CXCR4 as an entry receptor.

  • Translational Relevance:
    Understanding similarities and differences between bovine and human CXCR4 helps determine the translational value of bovine models for human disease research. Areas with high conservation suggest findings may be directly applicable across species.

  • Drug Development:
    Comparative analysis guides the development of broad-spectrum versus species-specific CXCR4-targeting compounds. For instance, the observation that [68Ga]Pentixafor binds human but not murine CXCR4 highlights the importance of species-specific validation for imaging and therapeutic agents.

  • Functional Domains:
    Cross-species functional studies can identify domains responsible for specific aspects of CXCR4 biology. For example, migration studies in chicken primordial germ cells demonstrated that CXCR4 knockout significantly reduced migratory capacity , suggesting a conserved role in directional cell migration that likely extends to bovine systems.

A thorough comparative analysis across bovine, human, murine, and other mammalian CXCR4 proteins would provide a foundation for selecting appropriate experimental models and interpreting results in a species-specific context.

What are common challenges in recombinant bovine CXCR4 expression and how can they be addressed?

Researchers working with recombinant bovine CXCR4 may encounter several challenges:

Low Expression Levels:

  • Problem: G-protein-coupled receptors like CXCR4 often express poorly in heterologous systems

  • Solution:

    • Optimize codon usage for the expression host

    • Include molecular chaperones to assist folding

    • Use expression tags that enhance folding and trafficking

    • Consider inducible expression systems with lower toxicity

Improper Membrane Trafficking:

  • Problem: Recombinant CXCR4 may accumulate in the endoplasmic reticulum or Golgi

  • Solution:

    • Include proper signal sequences

    • Optimize temperature (30-32°C often improves trafficking)

    • Add trafficking enhancers like SSTR3 or rhodopsin N-terminal tags

    • Use cell lines with robust membrane protein expression machinery

Functional Verification:

  • Problem: Surface expression doesn't guarantee functional activity

  • Solution:

    • Use multiple complementary functional assays

    • Include positive controls (human CXCR4)

    • Verify ligand binding using labeled SDF-1 or antagonists

    • Confirm activation of known downstream pathways

Receptor Heterogeneity:

  • Problem: Variable glycosylation or other post-translational modifications

  • Solution:

    • Use glycosylation site mutants for more homogeneous preparations

    • Employ tunicamycin to generate unglycosylated receptors for specific applications

    • Characterize different receptor populations by mass spectrometry

Antibody Cross-reactivity:

  • Problem: Limited availability of bovine-specific CXCR4 antibodies

  • Solution:

    • Test antibodies against conserved epitopes

    • Include proper controls (CXCR4 knockout cells)

    • Generate bovine-specific antibodies if necessary

    • Use epitope tags as detection alternatives

It's worth noting that even with established human CXCR4 expression systems, variable expression levels can occur. Commercial systems have been developed with defined expression levels (400 versus 9,500 molecules/cell) , highlighting the importance of quantitative characterization of receptor expression.

How can I optimize functional assays for bovine CXCR4 to ensure reproducibility and biological relevance?

Optimizing functional assays for bovine CXCR4 requires attention to several key factors:

Assay Standardization:

  • Use consistent passage numbers for cell lines

  • Standardize cell density and culture conditions

  • Include internal standards and calibration curves

  • Normalize results to receptor expression levels

  • Perform assays in at least triplicate with multiple biological replicates

Ligand Considerations:

  • Use fresh preparations of chemokines (SDF-1 tends to aggregate over time)

  • Include positive controls (human SDF-1 if bovine SDF-1 is unavailable)

  • Test multiple ligand concentrations to establish dose-response relationships

  • Consider the presence of GAGs that may modulate ligand activity

Assay Selection:

  • Choose assays appropriate for the research question:

    • Migration assays for chemotactic function

    • Calcium flux for immediate signaling responses

    • Phospho-ERK for MAPK pathway activation

    • Gene expression for long-term cellular responses

  • Match assay sensitivity to expected signal magnitude

Controls and Validation:

  • Include both positive and negative controls in each experiment:

    • CXCR4 antagonists (AMD3100) as negative controls

    • Cells lacking CXCR4 expression

    • Positive controls (e.g., fetal bovine serum for migration assays)

  • Validate critical findings with complementary assays

  • Confirm specificity with genetic approaches (CXCR4 knockout or knockdown)

Physiological Relevance:

  • Consider using primary bovine cells where possible

  • Match experimental conditions to physiological parameters:

    • Temperature (37°C)

    • pH (7.2-7.4)

    • Calcium and magnesium concentrations

    • Serum components that may influence receptor function

  • Consider three-dimensional culture systems for more physiologically relevant contexts

Following these guidelines will help ensure that functional assays provide reproducible and biologically meaningful data about bovine CXCR4 activity, allowing for valid comparisons with CXCR4 from other species and contributing to a better understanding of this important receptor's biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.