Recombinant Bovine CAAX prenyl protease 2 (RCE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type during order placement for prioritized development.
Synonyms
RCE1; CAAX prenyl protease 2; Farnesylated proteins-converting enzyme 2; FACE-2; Prenyl protein-specific endoprotease 2; RCE1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
RCE1
Target Protein Sequence
MAALGGDGFRLLSVSRPERQPESAALGGPGPGLCCWVSVFSCLSLACSYVGSLYVWKSEL PRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL LLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFR ACMLPMLAPCTGLGPAVFTCPLFFGVAHFHHIFEQLRFRQSSVGSIFLSAGHLIGPVLCH SFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAG DSEAPLCS
Uniprot No.

Target Background

Function
This recombinant bovine CAAX prenyl protease 2 (RCE1) proteolytically removes the C-terminal three residues from farnesylated and geranylated proteins. It exhibits activity against K-Ras, N-Ras, H-Ras, RAP1B, and G-gamma-1.
Database Links
Protein Families
Peptidase U48 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the cellular localization and basic function of RCE1?

RCE1 is an integral membrane endoprotease localized to the endoplasmic reticulum that mediates the cleavage of the carboxyl-terminal "aaX" from proteins containing the CAAX motif. This proteolytic cleavage occurs following prenylation of the cysteine residue within the CAAX motif, representing the second step in a three-part post-translational modification sequence. The enzyme's position within the endoplasmic reticulum membrane is crucial for its function in processing newly synthesized CAAX proteins, which are subsequently trafficked to their appropriate cellular destinations .

Methodologically, researchers can verify RCE1 localization through subcellular fractionation techniques combined with western blotting or through fluorescence microscopy using tagged RCE1 constructs. Functional studies typically employ in vitro proteolysis assays with synthetic CAAX peptide substrates or cell-based assays measuring processing of model CAAX proteins.

What is the structural organization of RCE1?

Structural analyses of RCE1 and its homologs have revealed a complex membrane protein with seven or eight transmembrane segments, depending on the species. The enzyme contains a conical cavity with a large volume (approximately 1400 ų) that encompasses the catalytic site and opens to the cytosol. Critical conserved residues, including E140, E141, H173, H227, and N231, reside within this cavity and project their side chains inward, with the exception of E141 .

The functional architecture of RCE1 includes a water molecule located in the cavity approximately 10 Å from the cytosolic surface of the membrane, bridged by E140 and H173 positioned opposite one another. The cavity is accessible to the membrane environment through a gap between two transmembrane helices (TM2 and TM4), which likely facilitates substrate entry .

How does RCE1 differ from other CAAX proteases?

The substrate specificity of RCE1 can be experimentally determined using systematic mutagenesis of CAAX motifs in model substrates. For example, studies with a-factor variants containing all possible single amino acid substitutions at the a₁, a₂, or X positions have revealed that both Afc1p and Rce1p can proteolyze a-factor with A, V, L, I, C, or M at the a₁ position, V, L, I, C, or M at the a₂ position, or any amino acid at the X position that permits prenylation of the cysteine .

How can I express and purify recombinant bovine RCE1 for in vitro studies?

Recombinant bovine RCE1 expression presents challenges due to its multiple transmembrane domains. The recommended methodological approach involves:

  • Expression System Selection: Use insect cell systems (Sf9 or High Five) or mammalian expression systems (HEK293 or CHO cells) for proper folding and membrane insertion.

  • Construct Design: Engineer constructs with affinity tags (His₆, FLAG, or Strep) positioned to avoid interference with membrane topology. Consider adding a cleavable signal sequence to ensure proper membrane insertion.

  • Detergent Solubilization: After cell lysis, solubilize membranes using detergents such as CHAPS, DDM, or Triton X-100, with optimization required for bovine RCE1.

  • Affinity Purification: Employ affinity chromatography based on the incorporated tag, followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations.

  • Activity Verification: Confirm enzymatic activity using synthetic farnesylated CAAX peptide substrates in an endoprotease assay system that can monitor cleavage of the -aaX portion.

For activity assays, researchers can employ the "coupled endoproteolysis/methylation assay" which has been successfully used to demonstrate that human RCE1 processes various farnesylated and geranylgeranylated substrates with Km values of approximately 0.5 μM .

What are the optimal conditions for assessing RCE1 enzymatic activity?

The optimal conditions for assessing bovine RCE1 enzymatic activity include:

ParameterOptimal ConditionNotes
pH7.0-7.5Enzymatic activity declines significantly outside this range
Temperature30-37°C37°C mimics physiological conditions
Buffer50 mM HEPES or TrisSupplemented with 100-150 mM NaCl
Detergent0.1% DDM or CHAPSCritical for maintaining enzyme stability
Reducing agent1-5 mM DTT or β-MEPrevents oxidation of catalytic cysteines
Substrate0.5-5 μM farnesylated CAAX peptidesConcentration should be around Km (0.5 μM)
Divalent cations1-2 mM MgCl₂May enhance enzymatic activity

The assay should include appropriate controls such as heat-inactivated enzyme and RPI (a known RCE1 inhibitor with IC₅₀ of ~5 nM) to validate specificity . Activity can be monitored through HPLC, mass spectrometry, or using fluorescently labeled substrates with FRET-based detection methods.

How can knockout or knockdown models be generated to study RCE1 function?

Several approaches can be employed to create knockout or knockdown models for studying RCE1 function:

  • CRISPR-Cas9 Gene Editing:

    • Design guide RNAs targeting conserved exons of the RCE1 gene

    • Include homology-directed repair templates for precise modifications

    • Screen clones for mutations using sequencing and western blotting

    • Note that complete knockout may be lethal based on mouse embryonic studies

  • Conditional Knockout Systems:

    • Use Cre-loxP or Flp-FRT systems for tissue-specific or inducible deletion

    • Particularly valuable given that homozygous RCE1 knockout mice die around embryonic day 15

    • enables study of RCE1 function in specific adult tissues or at defined developmental stages

  • RNA Interference:

    • Design siRNAs or shRNAs targeting conserved regions of RCE1 mRNA

    • Test multiple sequences for optimal knockdown efficiency

    • Implement inducible shRNA systems for temporal control

    • Validate knockdown using qRT-PCR and western blotting

  • Pharmacological Inhibition:

    • Use specific RCE1 inhibitors like RPI (IC₅₀ ~5 nM) for acute inhibition studies

    • Compare results with genetic models to distinguish direct vs. adaptation effects

When implementing these approaches, researchers should monitor CAAX protein processing using model substrates (e.g., Ras proteins) to confirm functional consequences of RCE1 disruption.

How does the substrate specificity of bovine RCE1 compare with RCE1 from other species?

Bovine RCE1 shares structural and functional similarities with RCE1 from other mammalian species, but exhibits distinct substrate preferences compared to yeast or archaeal homologs. Comparative analysis reveals:

  • Mammalian RCE1 Conservation:

    • Human and bovine RCE1 show >85% sequence identity in catalytic domains

    • Both process farnesylated and geranylgeranylated CAAX proteins with similar efficiency

    • Conserved catalytic residues (E140, H173, H227) are essential across mammalian species

  • Yeast vs. Bovine RCE1:

    • Yeast Rce1p demonstrates broader substrate tolerance at the a₁ position compared to Afc1p

    • Mammalian RCE1 shows greater flexibility in processing geranylgeranylated substrates

    • Point mutations in yeast Rce1p (E139K, F189L, Q201R) alter substrate specificity, suggesting evolutionary divergence in substrate recognition

  • Archaeal RCE1 Homologs:

    • Crystal structure studies of archaeal homologs reveal a conical cavity containing conserved residues

    • Archaeal enzymes typically have fewer transmembrane segments

    • Substrate range is narrower than mammalian counterparts

To experimentally address these differences, researchers can employ comparative biochemistry approaches using recombinant enzymes from different species with standardized substrate panels, or perform cross-species complementation studies in knockout cell lines.

What is the functional significance of RCE1-mediated processing for different classes of CAAX proteins?

The functional impact of RCE1-mediated processing varies significantly between different CAAX protein families, revealing a complex relationship between post-translational modification and protein function:

  • Ras Family GTPases:

    • RCE1 processing is critical for proper plasma membrane localization of farnesylated Ras proteins

    • Inhibition of RCE1 leads to mislocalization and impaired signaling through Ras-dependent pathways

    • Experimental evidence from knockout studies demonstrates that RCE1 processing is essential for the function of farnesylated Ras proteins in development

  • Rho Family GTPases:

    • Surprisingly, geranylgeranylated Rho proteins do not require RCE1 processing for proper localization or actin remodeling functions

    • This differential requirement may be attributed entirely to the type of prenyl modification (farnesyl vs. geranylgeranyl)

    • This distinction suggests evolutionary pressure for maintaining two forms of prenylation

  • Nuclear Lamins:

    • RCE1 processes farnesylated nuclear lamins

    • The functional consequences of impaired processing on nuclear envelope integrity and function require further investigation

  • Other CAAX Proteins:

    • The requirement for RCE1 processing appears to correlate with the type of prenyl modification

    • Farnesylated proteins generally demonstrate greater dependence on RCE1-mediated processing than geranylgeranylated proteins

These differential requirements can be experimentally evaluated using targeted mutations in the CAAX box to force specific prenylation pathways, followed by functional and localization studies in RCE1-deficient backgrounds.

How does inhibition of RCE1 affect cellular signaling networks dependent on CAAX proteins?

Inhibition of RCE1 has widespread effects on cellular signaling networks due to the disruption of multiple CAAX protein processing pathways:

  • Ras-MAPK Signaling:

    • RCE1 inhibition causes mislocalization of farnesylated Ras proteins

    • This results in attenuated ERK activation in response to growth factors

    • The degree of signaling inhibition varies depending on cell type and the specific Ras isoform involved

  • PI3K-AKT Pathway:

    • RCE1-dependent processing affects PI3K recruitment and activation

    • This leads to altered AKT phosphorylation patterns

    • May impact cellular metabolism, survival, and growth

  • Cytoskeletal Organization:

    • Interestingly, despite processing Rho family GTPases, RCE1 inhibition has minimal impact on actin remodeling

    • This is consistent with findings that geranylgeranylated Rho proteins do not require RCE1 processing for function

  • Cell Cycle Progression:

    • Disruption of RCE1 function may alter cell cycle progression due to effects on multiple regulatory GTPases

    • Experimental approaches can include cell synchronization followed by flow cytometry analysis in RCE1-inhibited cells

Methodologically, researchers investigating these effects should employ phosphoproteomic approaches to capture global signaling changes, combined with specific pathway probes and live-cell imaging of fluorescently tagged CAAX proteins to track localization dynamics.

What is the potential of RCE1 inhibitors as therapeutic agents in disease models?

RCE1 inhibitors show promise as therapeutic agents across multiple disease contexts:

  • Cancer Therapy:

    • RCE1 inhibition affects farnesylated Ras proteins, which are frequently activated in human cancers

    • Unlike farnesyltransferase inhibitors, RCE1 inhibitors may disrupt signaling from already prenylated Ras proteins

    • Optimization should focus on selectivity and pharmacokinetic properties

    • Combination approaches with other pathway inhibitors may enhance efficacy

  • Anti-parasitic Applications:

    • RCE1 plays essential roles in parasites such as Plasmodium sp. (malaria) and Trypanosoma brucei (African sleeping sickness)

    • Inhibitors that preferentially target parasite RCE1 over human homologs could have clinical value

    • Structure-based design approaches leveraging differences between parasite and host enzymes offer promising avenues

  • Antibacterial Development:

    • Mammalian RCE1 regulates the modification and effectiveness of certain bacterial effector proteins injected into host cells

    • Prokaryotic RCE1 appears to regulate the pathogenicity of bacteria associated with high mortality rates, such as Staphylococcus aureus and Streptococcus pneumoniae

    • This presents opportunities for both host-directed and pathogen-directed therapeutic approaches

When evaluating potential RCE1 inhibitors, researchers should employ cellular target engagement assays, selective toxicity profiling against target organisms, and in vivo efficacy studies in appropriate disease models.

How can we develop selective assays to screen for RCE1 inhibitors?

Developing selective assays for RCE1 inhibitor screening requires consideration of the enzyme's membrane-bound nature and substrate specificity:

  • Substrate Selection and Design:

    • Engineer fluorogenic substrates containing optimal CAAX sequences

    • Include FRET pairs that report on proteolytic cleavage

    • Optimize substrate length for specificity (typically 7-15 amino acids)

    • Ensure proper prenylation of the cysteine residue (farnesyl or geranylgeranyl)

  • Assay Formats:

    Assay TypeAdvantagesConsiderations
    In vitro biochemicalDirect measure of enzyme inhibitionRequires purified enzyme in appropriate detergent
    Cell-based reporterAccounts for membrane permeabilityMay detect off-target effects
    BRET/FRET systemsReal-time monitoring in live cellsComplex to establish and validate
    Targeted proteomicsMonitors endogenous substrate processingLower throughput, higher complexity
  • Counter-screening Strategy:

    • Include related proteases (e.g., ZMPSTE24) to ensure selectivity

    • Test against other prenylation pathway enzymes

    • Evaluate effects on non-CAAX processing pathways

  • Assay Validation:

    • Use known inhibitors like RPI (IC₅₀ ~5 nM) as positive controls

    • Validate hits using orthogonal assays and target engagement studies

    • Confirm mechanism of action through enzyme kinetics and binding studies

When implementing these assays, researchers should carefully control for compound interference with detection systems and ensure that membrane-associated enzyme preparations maintain native activity profiles.

What are the developmental and physiological consequences of RCE1 dysfunction?

RCE1 dysfunction has profound developmental and physiological impacts, demonstrated through various experimental models:

  • Embryonic Development:

    • RCE1 knockout in mice is embryonic lethal, with most homozygous embryos dying around day 15 (E15)

    • Rare surviving RCE1-deficient mice are severely growth-restricted and die within weeks

    • The specific developmental processes disrupted remain incompletely characterized, suggesting multiple essential roles

  • Cellular Physiology:

    • RCE1 deficiency alters the localization and function of farnesylated Ras proteins

    • This impacts fundamental cellular processes including proliferation, differentiation, and survival

    • Interestingly, geranylgeranylated Rho proteins retain function even without RCE1 processing

  • Tissue-Specific Effects:

    • Conditional knockout models reveal tissue-specific requirements for RCE1

    • Cardiovascular, neural, and hematopoietic systems appear particularly sensitive to RCE1 dysfunction

    • These effects may be mediated through different subsets of CAAX proteins in each tissue context

  • Aging and Degenerative Processes:

    • Links between RCE1 function and premature aging phenotypes have been proposed but require further investigation

    • Connections to laminopathies and nuclear envelope integrity suggest potential roles in cellular aging processes

Methodologically, researchers investigating these consequences should employ conditional and inducible knockout systems to circumvent embryonic lethality, combined with detailed phenotypic characterization across multiple physiological systems and developmental stages.

What are the major technical challenges in working with recombinant RCE1?

Researchers face several significant technical challenges when working with recombinant RCE1:

  • Membrane Protein Expression:

    • RCE1's multiple transmembrane domains (7-8 predicted spans) make heterologous expression challenging

    • Protein folding and membrane insertion are often inefficient in standard expression systems

    • Low yields and inclusion body formation are common obstacles

    • Solution: Explore specialized expression systems including insect cells, mammalian cells, or cell-free systems with added microsomes

  • Maintaining Enzymatic Activity:

    • Activity is highly dependent on proper membrane environment and detergent conditions

    • Detergent selection critically affects enzyme stability and activity

    • Solution: Systematic screening of detergent types and concentrations, or reconstitution into nanodiscs or liposomes

  • Substrate Preparation:

    • Authentic substrates require prenylation of the cysteine residue

    • Generating prenylated peptides involves complex synthetic chemistry

    • Solution: Develop enzymatic methods for substrate preparation or establish collaboration with specialized chemistry groups

  • Assay Development:

    • Traditional protease assays may not be directly applicable due to membrane constraints

    • Background signal from non-specific proteolysis can confound results

    • Solution: Design highly specific FRET-based substrates and optimize buffer conditions to minimize background

  • Structural Analysis:

    • Obtaining high-resolution structures of mammalian RCE1 remains challenging

    • The protein's flexibility and membrane environment complicate crystallization

    • Solution: Explore cryo-EM approaches or use archaeal homologs as structural models

How can we resolve contradictory findings regarding RCE1 substrate specificity?

The literature contains several apparent contradictions regarding RCE1 substrate specificity that require careful resolution:

  • Methodological Differences:

    • Various studies employ different assay systems (in vitro vs. cellular)

    • Substrate design and concentrations vary significantly between studies

    • Solution: Conduct systematic comparisons using standardized assay conditions and diverse substrate panels

  • Species-Specific Variations:

    • Yeast, mammalian, and archaeal RCE1 homologs exhibit distinct substrate preferences

    • Results from one system may not translate to others

    • Solution: Perform direct cross-species comparisons using identical substrate sets

  • Prenylation-Type Dependence:

    • Some studies indicate that RCE1 processing is critical for farnesylated but not geranylgeranylated proteins

    • Others report processing of both types with similar efficiency

    • Solution: Design experiments that specifically control prenylation type while keeping other substrate features constant

  • Context-Dependent Processing:

    • Processing efficiency may depend on substrate features beyond the CAAX motif

    • Solution: Systematically test the influence of upstream sequences on processing efficiency

  • Data Integration Approach:

    • Compile comprehensive datasets across multiple studies

    • Perform meta-analysis to identify consistent patterns

    • Develop predictive models of substrate recognition incorporating multiple factors

To resolve these contradictions, researchers should design experiments that directly test competing hypotheses using well-controlled systems and multiple complementary methodologies.

What emerging technologies might advance RCE1 research?

Several cutting-edge technologies hold promise for overcoming current limitations in RCE1 research:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy for membrane protein structures

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • AlphaFold and related AI tools for structure prediction and modeling

    • These methods may provide insights into RCE1's catalytic mechanism and substrate recognition

  • Genome Editing Technologies:

    • CRISPR-Cas9 base editing for precise point mutations

    • Prime editing for scarless genomic modifications

    • Inducible degron systems for acute protein depletion

    • These tools enable more sophisticated genetic models to study RCE1 function

  • Single-Cell Technologies:

    • Single-cell proteomics to detect cell-to-cell variation in RCE1-dependent processes

    • Live-cell imaging with enhanced spatiotemporal resolution

    • Single-molecule enzymology approaches

    • These methods can reveal heterogeneity in RCE1 function across cell populations

  • Chemical Biology Tools:

    • Activity-based protein profiling for RCE1

    • Photo-crosslinking substrate analogs to map binding sites

    • Biorthogonal chemistry for tracking prenylated proteins in vivo

    • These approaches enable detailed mechanistic studies of RCE1 function

  • Systems Biology Integration:

    • Multi-omics approaches to characterize global effects of RCE1 modulation

    • Network analysis to identify key nodes in RCE1-dependent pathways

    • Mathematical modeling of prenylation-dependent processes

    • These methods provide a comprehensive view of RCE1's role in cellular physiology

Researchers adopting these emerging technologies should focus on integrating multiple approaches to build a more complete understanding of RCE1 structure, function, and biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.