Recombinant Bovine Calcitonin gene-related peptide type 1 receptor (CALCRL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery time information, please consult your local distributors.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing your desired tag.
Synonyms
CALCRL; CGRPR; Calcitonin gene-related peptide type 1 receptor; CGRP type 1 receptor; Calcitonin receptor-like receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-462
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
ESEEENPDDLIQLGVTRNKIMTAQYECYQKIMQDPVQQTEGIYCNRTWDGWLCWNDVAAG TESMQHCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNL FYLTIIGHVLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVITIIHLTAVANN QALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLVVVAVFAEKQHLMWYYFLGWG FPLIPACIHAVARRLYYNDNCWISSDTQLLYIIHGPICAALLVNLFFLLNIVRVLITKLK VTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIAEEIYDYIINILMHYQGLLVS TIFCFFNGEVQAILRRNWNQYKIQFGNNFSHSDTLRSASYTVSTISDGTGYSHDCLSEHL NGKSIHDTDNVVIKPEKLYD
Uniprot No.

Target Background

Function
This receptor, in conjunction with RAMP1, functions as a receptor for calcitonin-gene-related peptide (CGRP). When combined with RAMP2 or RAMP3, it acts as a receptor for adrenomedullin. The activity of this receptor is mediated by G proteins that activate adenylyl cyclase.
Gene References Into Functions
  1. Research indicates that adrenomedullin mRNA and protein signaling were exclusively found in trophoblast binucleate cells (BNCs), while CRLR, RAMP2, and RAMP3 were detected in cotyledonary villous and caruncular epithelial cells. PMID: 23849271
Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CALCRL and what is its primary function in biological systems?

CALCRL (Calcitonin Receptor-Like Receptor), also known as CRLR, is a G protein-coupled receptor (GPCR) related to the calcitonin receptor family. It functions as a receptor for calcitonin gene-related peptide (CGRP) and adrenomedullin (AM), depending on its association with different receptor activity-modifying proteins (RAMPs).

The CALCRL protein is linked to one of three single transmembrane domain receptor activity-modifying proteins (RAMPs) that are essential for its functional activity:

  • When associated with RAMP1: produces a CGRP receptor

  • When associated with RAMP2: produces an adrenomedullin receptor (AM₁)

  • When associated with RAMP3: produces a dual CGRP/AM receptor (AM₂)

These receptors are linked to the G protein Gs, which activates adenylate cyclase, resulting in the generation of intracellular cyclic adenosine monophosphate (cAMP). CGRP receptors are found throughout the body, suggesting that CALCRL may modulate a variety of physiological functions in major systems including respiratory, endocrine, gastrointestinal, immune, and cardiovascular systems .

What is the structural composition of CALCRL?

CALCRL associated with RAMP1 produces the CGRP receptor, which is a transmembrane protein receptor composed of four chains. It is structured as a heterodimer protein composed of two polypeptide chains with different amino acid residue compositions. The sequence reveals multiple hydrophobic and hydrophilic regions throughout the four chains in the protein .

The N-terminal (Nt) extracellular domain of CALCRL is an autonomously folded unit with a well-defined structure involved in ligand binding and specificity. The Nt-CALCRL contains structural features characteristic of class B GPCRs, including six conserved cysteines and specific amino acid motifs (C-W, C-P, and G-x-W) that are critical for receptor function .

Full-length bovine CALCRL protein typically contains 440 amino acids (residues 23-462), with the mature protein having the following structural features:

  • N-terminal extracellular domain

  • Seven transmembrane domains

  • Intracellular C-terminal domain

How does CALCRL gene expression vary across different tissue types?

CALCRL expression has been reported in various tissues including brain, lung, blood vessels, liver, and intestinal tract. Based on EST (Expressed Sequence Tag) analysis, CALCRL transcripts have been isolated from B-cell/lung/testis, bone marrow, embryo, lung, and synovium libraries .

In the Mediterranean mussel, both CALCRL and CALC-like precursor transcripts show differential tissue expression patterns. The CALCRL receptors exhibit tissue-specific distribution:

  • CALCRIa and CALCRIc are expressed in most tissues but undetectable in gonads

  • CALCRIb and CALCRIIb have the most widespread distribution across all analyzed tissues

  • CALCRIIc is not expressed in gonads and gills

  • CALCRIIa is exclusively expressed in the mantle

What are the established methods for expressing and purifying recombinant CALCRL protein?

For expression and purification of recombinant CALCRL, researchers have successfully employed the following methodology:

  • Expression System Selection: E. coli is commonly used for recombinant CALCRL expression, particularly for the N-terminal domain .

  • Fusion Protein Approach: The N-terminal domain of CALCRL can be expressed as a fusion protein in E. coli. The protein typically forms inclusion bodies, requiring refolding procedures .

  • Refolding and Purification Protocol:

    • Isolate inclusion bodies from bacterial cultures

    • Solubilize inclusion bodies using denaturing agents

    • Perform protein refolding through gradual removal of denaturants

    • Purify the refolded protein to obtain a soluble monomeric form

  • Protein Verification:

    • Far-UV CD and fluorescence spectroscopy can be used to confirm that the purified protein is properly folded

    • Size exclusion chromatography to verify monomeric state

For bovine CALCRL, recombinant protein can be expressed with an N-terminal His tag (residues 23-462) in E. coli. The purified protein is often provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE .

What functional assays are available to validate CALCRL activity?

Several functional assays can be employed to validate CALCRL activity:

  • Ligand Binding Assays:

    • Competitive binding assays using radiolabeled ligands (e.g., ¹²⁵I-CGRP and ¹²⁵I-AM)

    • The N-terminal domain of CALCRL has been shown to inhibit ¹²⁵I-CGRP and ¹²⁵I-AM binding to rat uterus in a dose-dependent manner with IC₅₀ values of 0.25 and 0.29 μM, respectively

  • cAMP Production Assays:

    • Measurement of cAMP levels following CALCRL activation

    • Studies have shown that CALCRL activation leads to increased cAMP production with an EC₅₀ of approximately 9.0-15.6 nM in control cultures

    • Adenoviral hRAMP1 expression vector can enhance this response, increasing maximal cAMP production by 1.8±0.2-fold and decreasing the EC₅₀ to 2.3±0.8 nM

  • Promoter Activation Assays:

    • Luciferase reporter assays to measure CGRP promoter activity

    • CCD camera imaging systems allow measurement of promoter activity before and after treatments

    • CGRP treatment can increase promoter activity by approximately 2.2-fold

  • Calcium Mobilization:

    • In vitro assays measuring calcium accumulation in mantle edge tissue and mantle cells after treatment with CALC peptides

  • Gene Expression Analysis:

    • Quantitative real-time PCR to measure changes in endogenous CGRP mRNA levels

    • CGRP treatment has been shown to increase CGRP mRNA levels 3-4 fold after 4 hours

How can researchers effectively study CALCRL-RAMP interactions?

Studying CALCRL-RAMP interactions requires specialized approaches:

  • Gene Transfer Methods:

    • Adenoviral vectors can be used for effective gene transfer of RAMP1 (Ad CMV-hRAMP1)

    • This approach has been shown to decrease the EC₅₀ of CGRP-stimulated cAMP production and increase maximal response

  • Co-Immunoprecipitation:

    • To detect physical interactions between CALCRL and different RAMPs

    • Allows determination of which RAMP is associated with CALCRL in different tissues or conditions

  • Transgenic Animal Models:

    • Generation of transgenic mice expressing human RAMP1 in the nervous system using Cre-loxP system

    • Double-transgenic mice (containing both GFP-hRAMP1 and nestin-cre transgenes) have been used to study hRAMP1 effects in vivo

  • Functional Response Assessment:

    • Neurogenic inflammation models: CGRP injection into the whiskerpad of hRAMP1 transgenic mice showed 2.2±0.2-fold greater plasma extravasation compared to control mice

    • Substance P release assays: Enhanced CGRP-induced release of substance P after Ad CMV-hRAMP1 gene transfer, particularly at low CGRP concentrations (5 nM)

  • Western Blot Analysis:

    • Quantification of RAMP1, CLR, and RCP protein levels

    • Transgenic nestin/hRAMP1 mice showed 1.9±0.1-fold greater RAMP1 signal than control littermates, with comparable levels of CLR and RCP

How does RAMP1 overexpression affect CALCRL function in experimental models?

RAMP1 overexpression significantly alters CALCRL function through multiple mechanisms:

  • Enhanced Receptor Sensitivity:

    • In cultured trigeminal ganglion neurons, adenoviral hRAMP1 gene transfer decreases the EC₅₀ for CGRP-stimulated cAMP production from 9.0±5.9 nM (uninfected) or 14.4±5.24 nM (control virus) to 2.3±0.76 nM

    • Increases maximal response by 1.8±0.19-fold compared to control cells

  • Altered Receptor Cooperativity:

    • Increased Hill coefficient from 0.91±0.15 to 2.6±0.8 after hRAMP1 overexpression

    • This suggests potential cooperativity among receptor subunits or changes in stimulus-response coupling

  • Enhanced In Vivo Response:

    • Transgenic mice expressing hRAMP1 in the nervous system displayed 2.2±0.2-fold greater plasma extravasation after CGRP injection

    • This demonstrates that RAMP1 is functionally rate-limiting for CGRP receptor activity

  • Sensitization to Low Ligand Concentrations:

    • At low CGRP concentrations (5 nM), RAMP1 overexpression enables significant substance P release that is not observed in control cultures

    • This indicates enhanced receptor sensitivity at physiologically relevant concentrations

  • No Compensation by Other Components:

    • Despite increased RAMP1 levels (1.9±0.1-fold) in transgenic mice, CLR and RCP levels remained unchanged (1.1±0.1 and 1.0±0.1-fold, respectively)

    • This suggests that increased receptor function occurs without compensatory changes in other receptor components

These findings indicate that RAMP1 is a rate-limiting factor for CALCRL function, and its overexpression may sensitize tissues to CGRP actions, with potential implications for conditions like migraine.

What is the role of CALCRL in disease pathology and how might it be targeted therapeutically?

CALCRL is implicated in several disease pathologies with potential therapeutic applications:

Therapeutic approaches targeting CALCRL could include:

  • Receptor antagonists (similar to BIBN4096BS for migraine)

  • siRNA or antisense oligonucleotides to modulate CALCRL expression

  • Targeting of regulatory elements (such as enhancers) affecting CALCRL expression

  • Modulation of the interaction between CALCRL and specific RAMPs

What is known about the N-terminal domain of CALCRL and its role in ligand binding?

The N-terminal domain of CALCRL plays a crucial role in ligand binding:

  • Structural Characteristics:

    • The N-terminal (Nt) extracellular region of CALCRL is an autonomously folded unit with a well-defined structure

    • Far-UV CD and fluorescence spectra of Nt-CALCRL show characteristics of a folded protein

    • Contains six conserved cysteines and specific amino acid motifs (C-W, C-P and G-x-W) that are critical for receptor function

  • Ligand Binding Properties:

    • Nt-CALCRL can bind CGRP and AM independently of RAMPs

    • Inhibits ¹²⁵I-CGRP and ¹²⁵I-AM binding to rat uterus in a dose-dependent fashion with IC₅₀ values of 0.25 and 0.29 μM, respectively

    • A significant part of the binding affinity for ligands comes from binding to the Nt-domain

  • Expression and Purification:

    • Can be cloned and expressed as a fusion protein in E. coli

    • Overexpressed protein forms inclusion bodies that require refolding

    • After refolding and purification, results in a soluble monomeric protein

  • Functional Significance:

    • Similar to other class B GPCRs (like glucagon and parathyroid hormone receptors), where the N-terminal domain plays a crucial role in ligand binding

    • The N-terminal domain contributes to both ligand binding affinity and specificity

These findings suggest that the N-terminal domain of CALCRL makes a substantial contribution to receptor function and could be a potential target for therapeutic interventions aimed at modulating CALCRL activity.

How do evolutionary relationships inform our understanding of CALCRL function across species?

Evolutionary analysis of CALCRL provides important insights into its function:

  • Phylogenetic Conservation:

    • CALCRL is found across diverse species from molluscs to vertebrates, suggesting it is part of an ancient calcium regulatory system of mineralization

    • Lophotrochozoan family B GPCRs (including CALCRL) share a common ancestral origin with receptor homologues found in vertebrates and other protostomes (nematodes and arthropods)

  • Receptor Subfamilies:

    • In molluscs, two main CALCRL receptor sub-clusters exist: CALCRL-type I and CALCRL-type II

    • These likely emerged from a specific gene duplication event early in lophotrochozoan lineage

    • Species-specific expansions occurred, with mussels possessing the most diverse repertoire of CALCRL receptors

  • Genomic Architecture:

    • Comparative analysis of CALCRL-like genes between molluscs and vertebrates revealed at least seventeen flanking gene families that descended from common ancestry

    • This confirms the orthologous relationship between vertebrate and mollusc CALCRL-like genes

  • Functional Conservation:

    • In molluscs, the CALC-system is implicated in shell mineralization

    • In vertebrates, CALCRL is involved in calcium homeostasis

    • This suggests that CALCRL is part of an ancient and conserved calcium regulatory system

  • Receptor-Ligand Co-evolution:

    • Both CALCRL-like receptors and CALC-like peptide precursors are found across diverse species

    • In the Mediterranean mussel, six CALCRL-like receptors and two CALC-precursors encoding four putative mature peptides were identified

    • Only specific receptor-ligand pairs are functional (e.g., mussel CALCRIIc is activated by mussel CALCIIa peptide with EC₅₀ = 2.6×10⁻⁵ M)

This evolutionary perspective helps researchers understand the fundamental roles of CALCRL and suggests that certain core functions have been conserved across hundreds of millions of years of evolution.

What are the optimal storage and handling conditions for recombinant CALCRL protein?

For optimal storage and handling of recombinant CALCRL protein:

  • Storage Temperature:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Reconstitution Protocol:

    • Briefly centrifuge vial prior to opening to bring contents to the bottom

    • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% of glycerol (final concentration) for long-term storage at -20°C/-80°C

  • Working Solutions:

    • For short-term use, working aliquots can be stored at 4°C for up to one week

    • Repeated freezing and thawing is not recommended

  • Buffer Composition:

    • Typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Quality Control:

    • Verify protein purity by SDS-PAGE before use (should be greater than 90%)

    • For functional studies, confirm protein activity after reconstitution using appropriate assays

What are the methodological challenges in studying CALCRL-RAMP interactions and how can they be overcome?

Studying CALCRL-RAMP interactions presents several challenges:

  • Heteromeric Receptor Complexes:

    • Challenge: CALCRL functions as part of a heteromeric complex with RAMPs, making it difficult to study individual components

    • Solution: Use co-expression systems where CALCRL and specific RAMPs are expressed together, or develop RAMP-specific antibodies to distinguish different receptor complexes

  • Transient Interactions:

    • Challenge: CALCRL-RAMP interactions may be transient or context-dependent

    • Solution: Use crosslinking approaches or bioluminescence/fluorescence resonance energy transfer (BRET/FRET) to capture real-time interactions

  • Receptor Trafficking:

    • Challenge: RAMPs influence CLR glycosylation and cell-surface trafficking

    • Solution: Use cell surface biotinylation or fluorescently tagged receptors to track trafficking in real-time

  • Complex Signaling Pathways:

    • Challenge: CALCRL can couple to multiple G-protein subtypes (Gαs, Gαi, Gαq)

    • Solution: Use pathway-specific inhibitors or biosensors to dissect specific signaling events downstream of receptor activation

  • Lack of Specific Tools:

    • Challenge: Limited availability of specific antibodies or small molecule modulators

    • Solution: Develop receptor subtype-specific antibodies, or use gene editing techniques like CRISPR/Cas9 to tag endogenous proteins

  • Variable Receptor Component Levels:

    • Challenge: Expression levels of CALCRL and RAMPs may vary across tissues or experimental systems

    • Solution: Quantify absolute levels of each component using quantitative PCR, Western blotting, or mass spectrometry to account for this variability

What are the critical factors to consider when designing experiments to investigate CALCRL-mediated signaling?

When designing experiments to investigate CALCRL-mediated signaling, researchers should consider:

  • Receptor-RAMP Composition:

    • Different RAMP associations produce receptors with distinct ligand preferences and signaling properties

    • Ensure experimental systems express the appropriate RAMP for the receptor subtype being studied

    • Consider that RAMP1 is functionally rate-limiting for CGRP receptor activity

  • Ligand Concentration Range:

    • Use appropriate concentration ranges based on known EC₅₀ values:

      • For CGRP: EC₅₀ ranges from 2.3 nM (with hRAMP1 overexpression) to 15.6 nM (control systems)

      • For mussel CALCIIa peptide: EC₅₀ = 2.6×10⁻⁵ M

    • Include both sub-threshold and saturating concentrations to capture full dose-response relationships

  • Temporal Considerations:

    • Rapid responses: cAMP production occurs within minutes

    • Intermediate responses: CGRP promoter activation at 4-6 hours

    • Long-term responses: changes in gene expression may require 24+ hours

    • Design time-course experiments to capture these different phases

  • Signaling Pathway Selection:

    • Primary pathway: Gs-coupled adenylate cyclase/cAMP pathway

    • Alternative pathways: Consider potential coupling to Gi or Gq

    • Measure multiple signaling outputs (cAMP, calcium, ERK activation) to get a complete picture

  • Experimental Controls:

    • Positive controls: Forskolin for cAMP production assays

    • Negative controls: Receptor antagonists like BIBN4096BS

    • Vehicle controls for all treatments

  • Tissue/Cell Specificity:

    • CALCRL expression varies across tissues

    • Consider tissue-specific effects when designing and interpreting experiments

    • Use appropriate cell models that reflect the tissue of interest

  • Experimental Validation:

    • Validate key findings using multiple approaches (e.g., pharmacological and genetic)

    • Confirm in vitro findings with in vivo models when possible

    • Consider species differences in receptor pharmacology and function

How can CALCRL research contribute to understanding migraine pathophysiology?

CALCRL research has significant implications for migraine pathophysiology:

  • CGRP Receptor Sensitization:

    • The neuropeptide CGRP from the trigeminal ganglion is established as a key player in migraine pathogenesis

    • RAMP1 is functionally rate-limiting for CGRP receptor activity in the trigeminal ganglion

    • Elevated RAMP1 might sensitize individuals to CGRP actions in migraine

  • Molecular Mechanisms of CGRP Action:

    • Activation of CGRP receptors on cultured trigeminal ganglion neurons increases endogenous CGRP mRNA levels and promoter activity through a cAMP-dependent pathway

    • CGRP antagonists like BIBN4096BS, which are effective antimigraine drugs, block this promoter activation

  • Multiple Sites of CGRP Action in Migraine:

    • CGRP receptors on cerebrovasculature cause vessel relaxation blockable by BIBN4096BS

    • CGRP receptors on dural mast cells release cytokines and inflammatory agents during neurogenic inflammation

    • Postsynaptic CGRP receptors on second-order sensory neurons within brainstem trigeminal nuclei

    • CGRP receptors in the trigeminal ganglion may represent a fourth site relevant for CGRP and BIBN4096BS actions in migraine

  • Neurogenic Inflammation Model:

    • In transgenic mice expressing hRAMP1 in the nervous system, CGRP injection produces enhanced plasma extravasation (2.2±0.2-fold greater)

    • This represents a measure of neurogenic inflammation relevant to migraine mechanisms

  • Substance P Release:

    • CGRP-evoked release of substance P is enhanced with increased RAMP1 expression

    • This effect is most striking at low CGRP concentrations (5 nM), suggesting increased sensitivity to physiological concentrations of CGRP

These insights provide a molecular basis for developing targeted migraine therapies and explain the clinical efficacy of CGRP receptor antagonists and antibodies targeting the CGRP pathway.

What are the emerging applications of CALCRL research in cancer biology?

CALCRL research shows promising applications in cancer biology, particularly in:

What new methodologies are being developed to study CALCRL and its associated signaling pathways?

Several innovative methodologies are advancing CALCRL research:

  • CRISPR/Cas9 Gene Editing:

    • CRISPR deletion of regulatory elements (such as rs880890 enhancer) that control CALCRL expression

    • This approach has demonstrated that deletion results in downregulation of CALCRL expression

    • Targeted gene perturbations using siRNA and CRISPR/Cas9 in human aortic endothelial cells

  • Epigenetic and Transcriptional Analysis:

    • Integration of RNA-seq and ATAC-seq (transposase-accessible chromatin with sequencing)

    • Chromatin immunoprecipitation assay-quantitative polymerase chain reaction

    • Electromobility shift assays to study protein-DNA interactions at regulatory elements

  • Luciferase Reporter Assays:

    • Real-time monitoring of promoter activity using sensitive CCD camera imaging systems

    • This allows measurement of promoter activity from the same cultures before and after treatments

  • Patient-Derived Xenograft Models:

    • Use of patient-derived xenograft models to study the effects of CALCRL knockdown on leukemic growth, LSC frequency, and sensitivity to chemotherapy

  • Advanced Imaging Techniques:

    • Fluorescence-based techniques to track receptor trafficking and protein-protein interactions

    • Live-cell imaging to monitor dynamic processes in real-time

  • Transgenic Animal Models:

    • Development of conditional transgenic models using Cre-loxP system

    • Creation of tissue-specific CALCRL or RAMP knockout/overexpression models

  • Systems Biology Approaches:

    • Integration of transcriptomic, proteomic, and functional data to understand CALCRL signaling networks

    • Computational modeling of signaling pathways to predict cellular responses

These methodological advances are providing new insights into CALCRL biology and opening avenues for therapeutic targeting in various disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.