Recombinant Bovine Calcium-binding mitochondrial carrier protein SCaMC-1 (SLC25A24)

Shipped with Ice Packs
In Stock

Description

Calcium-Dependent ATP Transport

  • SCaMC-1 imports ATP-Mg²⁺ into mitochondria in exchange for PiPi, driven by cytosolic Ca2+Ca^{2+} levels .

  • At Ca2+Ca^{2+} concentrations >1 μM, transport activity increases 3–5 fold, ensuring mitochondrial ATP supply during cellular stress .

Role in Mitochondrial Calcium Buffering

  • ATP imported by SCaMC-1 enhances Ca2+Ca^{2+} sequestration in the matrix by forming insoluble Ca2+Ca^{2+}-phosphate precipitates .

  • Knockdown experiments in cancer cells (e.g., 143B, COS-7) reduced mitochondrial Ca2+Ca^{2+} buffering capacity by 50–60%, increasing susceptibility to permeability transition pore (mPTP) opening .

Cancer Biology

  • Overexpression in Tumors: SCaMC-1 is upregulated in multiple cancers, including liver, breast, and osteosarcoma, where it promotes resistance to Ca2+Ca^{2+}-induced cell death .

    • Mechanism: Enhanced ATP-Mg²⁺ import desensitizes mPTP, reducing necrosis under oxidative stress .

    • Therapeutic Target: Silencing SCaMC-1 sensitizes cancer cells to H2O2H_2O_2-induced death by 40–70% .

Genetic Disorders

  • Gorlin–Chaudhry–Moss Syndrome: Mutations (e.g., Arg217His/Cys) in SLC25A24 disrupt ATP-Mg²⁺ transport, leading to craniofacial dysplasia and mitochondrial dysfunction .

Research Applications

ApplicationExperimental ModelKey Findings
Calcium flux assaysPermeabilized 143B cells3x higher mitochondrial Ca2+Ca^{2+} uptake in SCaMC-1-KD vs. controls
mPTP sensitivityCOS-7 cellsCRC (Ca²⁺ retention capacity) reduced by 30% in KD cells
Structural studiesX-ray crystallographyN-terminal EF-hands adopt calmodulin-like folds upon Ca2+Ca^{2+} binding

Comparative Analysis with Orthologs

FeatureBovine SCaMC-1Human SCaMC-1
EF-hand domains2 functional sites4 predicted sites
Isoforms2 (A and B)3 (APC1, APC2, APC3)
Tissue expressionUbiquitousHigh in liver, kidney

Future Directions

  • Drug Development: Targeting SCaMC-1’s EF-hand domain could modulate Ca2+Ca^{2+}-dependent ATP transport in cancer .

  • Gene Therapy: CRISPR-based correction of SLC25A24 mutations may alleviate mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SLC25A24; SCAMC1; Calcium-binding mitochondrial carrier protein SCaMC-1; Small calcium-binding mitochondrial carrier protein 1; Solute carrier family 25 member 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-477
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
SLC25A24
Target Protein Sequence
MLRWLRGFVLPTAACQDVEPPTRYETLFQKLDRNGDGVVDISELQEGLKSLGIPLGQDAE EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQILGL TISEQQAELILQSIDADGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTI PDEFTEDEKKSGQWWRQLLAGGVAGAVSRTSTAPLDRLKVMMQVHGSKSAKMNIYGGFQQ MVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFVSGSMAGA TAQTFIYPMEVLKTRLAVGKTGQYSGMFDCAKKILKYEGMGAFYKGYVPNLLGIIPYAGI DLAVYELLKSHWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMIE KSPQLNMVGLFRRILSKEGLPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
Uniprot No.

Target Background

Function

Recombinant Bovine Calcium-binding mitochondrial carrier protein SCaMC-1 (SLC25A24)

This protein functions as a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers transport metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. It may act as an ATP-Mg/Pi exchanger, mediating the transport of Mg-ATP in exchange for phosphate. This process catalyzes the net uptake or efflux of adenine nucleotides into or from the mitochondria.

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of SLC25A24 (SCaMC-1)?

SLC25A24, also known as SCaMC-1 (short calcium-binding mitochondrial carrier isoform 1) or APC1 (mitochondrial ATP-Mg/Pi carrier isoform 1), belongs to the solute carrier 25 (SLC25) family. This protein consists of three tandemly repeated homologous domains, each containing two transmembrane α-helices and one conserved mitochondrial carrier family (MCF) signature. Both N and C termini face the cytosolic side of the inner mitochondrial membrane, with six α-helices forming a compact inner mitochondrial transmembrane domain . The N-terminal domain forms a calcium-sensitive regulatory component containing EF-hand motifs that confer Ca²⁺ sensitivity to the carrier .

Functionally, SCaMC-1 mediates the electro-neutral and reversible exchange of ATP-Mg²⁻/Pi²⁻ and/or HADP²⁻/Pi²⁻ between the cytosol and mitochondria. This transport occurs in response to increased cytosolic calcium concentrations and is essential for maintaining optimal adenine nucleotide levels in the mitochondrial matrix . The carrier plays a crucial role in mitochondrial calcium buffering, which subsequently influences the mitochondrial permeability transition (mPT) process and cell survival pathways.

How should researchers properly reconstitute and store recombinant SCaMC-1 protein for experimental use?

For optimal experimental outcomes when working with recombinant SCaMC-1 protein, researchers should follow these evidence-based protocols:

Reconstitution Procedure:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) to stabilize the protein structure

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

Storage Recommendations:

  • Store unopened protein at -20°C/-80°C upon receipt

  • Working aliquots can be kept at 4°C for up to one week

  • For long-term storage, keep aliquots at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity and activity

These protocols ensure protein stability and functional integrity, which are essential for reliable experimental outcomes. For verification of protein purity and quality, SDS-PAGE analysis should show greater than 90% purity before proceeding with functional assays.

What are the paralogs of SCaMC-1 and how do they differ functionally?

In mammals, the ATP-Mg/Pi carrier family includes four paralogs: SCaMC-1 (SLC25A24), SCaMC-2 (SLC25A25), SCaMC-3 (SLC25A23), and SCaMC-3-like (SLC25A41) . While all are members of the mitochondrial carrier (MC) family, they exhibit distinctive tissue expression patterns and potentially specialized functions:

ParalogGene IDPrimary ExpressionFunctional Specialization
SCaMC-1SLC25A24Widely expressed in cancer and transformed cellsCa²⁺-dependent ATP-Mg/Pi transport; major role in mitochondrial Ca²⁺ buffering and cell survival
SCaMC-2SLC25A25Enriched in skeletal muscle and brainInvolved in thermogenesis and muscle energy metabolism
SCaMC-3SLC25A23Expressed in various tissues, particularly liverSimilar to SCaMC-1 but with potentially different Ca²⁺ sensitivity
SCaMC-3-likeSLC25A41Restricted expression patternLess characterized; may have specialized tissue-specific functions

SCaMC-1 is notably distinguished by its dominant expression in cancer cells and transformed cell lines. This expression pattern suggests a specialized role in cellular proliferation and survival mechanisms in rapidly dividing cells . The functional differences between paralogs are still being elucidated, but they likely reflect tissue-specific adaptations in mitochondrial calcium and adenine nucleotide homeostasis.

How does SCaMC-1 regulate mitochondrial calcium retention capacity and permeability transition?

SCaMC-1 plays a sophisticated role in regulating mitochondrial permeability transition through a calcium-dependent mechanism involving multiple pathways:

When cytosolic calcium levels increase, the calcium-binding EF hands in SCaMC-1's N-terminal domain undergo conformational changes that activate the carrier's transport function. This activation enables SCaMC-1 to mediate the uptake of ATP-Mg²⁻/Pi²⁻ and/or HADP²⁻/Pi²⁻ into the mitochondrial matrix . The imported adenine nucleotides contribute significantly to calcium buffering within the matrix, thereby increasing the mitochondrial calcium retention capacity (CRC).

This enhanced calcium buffering has critical implications for the mitochondrial permeability transition pore (mPTP). While low micromolar concentrations of ATP/ADP regulate mPTP opening through conformational changes in the adenine nucleotide translocase (ANT), the millimolar concentrations of adenine nucleotides transported by SCaMC-1 provide additional protection against mPTP formation . This creates a sophisticated negative feedback mechanism: as cytosolic calcium increases (potentially triggering mPTP), SCaMC-1 activation counteracts this effect by enhancing mitochondrial calcium buffering capacity.

Experimental evidence demonstrates that knockdown of SCaMC-1 dramatically reduces mitochondrial calcium retention capacity and sensitizes cells to mPT-mediated necrotic death triggered by oxidative stress and calcium overload . Conversely, overexpression of SCaMC-1 increases resistance to calcium-dependent mPTP opening and subsequent cell death.

What methodologies are recommended for studying SCaMC-1 function in mitochondrial calcium dynamics?

To effectively investigate SCaMC-1's role in mitochondrial calcium handling, researchers should implement a multi-faceted experimental approach:

Genetic Manipulation Techniques:

  • Generate stable SCaMC-1 knockdown cell lines using RNA interference or CRISPR/Cas9 technology

  • Create SCaMC-1 overexpression systems in cells with naturally low expression levels (e.g., liver clone-9 cells)

  • Develop site-directed mutagenesis of calcium-binding domains to assess structure-function relationships

Functional Assays for Mitochondrial Calcium Dynamics:

  • Calcium Retention Capacity (CRC) Assay: Monitor calcium uptake capacity of isolated mitochondria using calcium-sensitive fluorescent indicators (e.g., Calcium Green-5N)

  • Mitochondrial Membrane Potential Assessment: Utilize potentiometric dyes like TMRM or JC-1 to monitor mPTP-dependent depolarization

  • Live-Cell Calcium Imaging: Employ targeted calcium indicators (e.g., mitochondria-targeted aequorin) to measure matrix calcium concentrations in real-time

  • Mitochondrial Swelling Assays: Measure changes in light scattering to detect mPTP opening in response to calcium challenges

Cell Death Analysis in the Context of SCaMC-1 Function:

  • Compare sensitivity to oxidative stress-induced necrosis versus apoptotic stimuli in SCaMC-1-modified cells

  • Differentiate between mPT-dependent and independent death pathways using specific inhibitors (e.g., cyclosporin A)

  • Combine calcium imaging with cell viability assays to correlate calcium dysregulation with death outcomes

When implementing these methodologies, it is critical to validate SCaMC-1 expression levels via Western blotting and to verify subcellular localization using immunofluorescence microscopy to ensure experimental accuracy.

What role does SCaMC-1 play in cancer cell metabolism and survival?

SCaMC-1 emerges as a critical regulator of cancer cell survival through multiple interconnected mechanisms:

Comprehensive gene expression analysis reveals that SCaMC-1 overexpression is a general feature of transformed and cancer cells . This elevated expression provides cancer cells with enhanced resistance to oxidative stress and calcium overload-induced cell death through the following mechanisms:

  • Enhanced Mitochondrial Calcium Buffering: By increasing adenine nucleotide transport into mitochondria, SCaMC-1 boosts calcium retention capacity, allowing cancer cells to withstand higher calcium loads without triggering mPTP opening .

  • Metabolic Adaptation: The regulated exchange of ATP-Mg and phosphate between cytosol and mitochondria helps maintain optimal adenine nucleotide levels in the mitochondrial matrix, potentially supporting the altered metabolic demands of cancer cells .

  • Selective Protection Against Necrotic Cell Death: Notably, SCaMC-1 knockdown sensitizes cells specifically to oxidative stress-induced death (H₂O₂ and menadione) but not to staurosporine-induced apoptosis . This suggests SCaMC-1 primarily protects against mPT-dependent necrotic cell death pathways.

Experimentally, the critical role of SCaMC-1 in cancer cell survival is supported by multiple lines of evidence:

  • SCaMC-1 knockdown cells show vastly reduced mitochondrial calcium buffering capacity

  • Re-expression of SCaMC-1 in knockdown cells restores resistance to H₂O₂-induced death

  • Overexpression of SCaMC-1 in cells with naturally low levels confers resistance to both H₂O₂ and C₂-ceramide-induced death

These findings position SCaMC-1 as a potential therapeutic target for cancer treatment, potentially allowing selective sensitization of cancer cells to oxidative stress-induced death while sparing normal tissues with lower SCaMC-1 expression.

How do mutations in SLC25A24 contribute to human disease pathology?

De novo mutations in SLC25A24 have been identified as causative factors for Fontaine syndrome, a distinct disorder characterized by early aging, congenitally decreased subcutaneous fat tissue, sparse hair, bone dysplasia of the skull and fingers, a distinctive facial gestalt, and both prenatal and postnatal growth retardation .

Molecular Basis of Pathogenic Mutations:

The specific de novo missense variants identified in Fontaine syndrome patients include:

  • c.649C>T (p.Arg217Cys)

  • c.650G>A (p.Arg217His)

Molecular dynamic simulation studies reveal that these mutations significantly alter protein function by:

  • Narrowing the substrate cavity of SLC25A24

  • Disrupting transporter dynamics essential for ATP-Mg/Pi exchange

Pathophysiological Consequences:

The disruption of SLC25A24 function has profound cellular consequences that explain the disease phenotype:

  • Impaired Adenine Nucleotide Homeostasis: Compromised ATP-Mg/Pi transport disrupts mitochondrial energy metabolism

  • Calcium Handling Defects: Reduced mitochondrial calcium buffering may increase cellular vulnerability to stress

  • Premature Cellular Senescence: Consistent with the premature aging phenotype observed in patients

It is particularly significant that the mutations affect the arginine residue at position 217, which appears to be critical for proper transporter dynamics. The high conservation of this residue across species underscores its functional importance. These findings highlight how specific structural alterations in SLC25A24 can have wide-ranging physiological consequences, connecting mitochondrial calcium and adenine nucleotide homeostasis to human developmental pathology.

What are the optimal expression systems for producing high-quality recombinant SCaMC-1 protein?

The selection of an appropriate expression system is critical for obtaining functionally relevant recombinant SCaMC-1 protein. Based on current research protocols and protein characteristics, the following systems offer distinct advantages:

E. coli Expression System:

  • Currently the most documented system for SCaMC-1 production

  • Yields full-length protein with N-terminal His-tag

  • Advantages: High yield, cost-effective, established purification protocols

  • Limitations: Potential issues with proper folding of calcium-binding domains and post-translational modifications

  • Recommended strain: BL21(DE3) with expression under control of T7 promoter

Mammalian Expression Systems:

  • HEK293 or CHO cells provide superior folding for complex mammalian proteins

  • More likely to preserve native calcium-binding properties and post-translational modifications

  • Recommended for functional studies where proper protein conformation is critical

  • Lower yield but potentially higher functional relevance

Insect Cell Systems:

  • Sf9 or Hi5 cells using baculovirus expression vectors

  • Represent a compromise between bacterial and mammalian systems

  • Good for membrane proteins like SCaMC-1 that require complex folding

How can researchers effectively measure SCaMC-1 transport activity in isolated mitochondria?

Measuring SCaMC-1 transport activity requires carefully designed assays that account for its calcium-dependent regulation and specific transport substrates. The following methodological approaches provide robust assessment of SCaMC-1 function:

Reconstituted Liposome Transport Assays:

  • Purify recombinant SCaMC-1 protein with minimal detergent exposure

  • Reconstitute into phospholipid vesicles (liposomes) containing appropriate buffer

  • Initiate transport by adding radiolabeled substrates (³²P-ATP-Mg²⁻) externally

  • Sample at defined time points and measure uptake using scintillation counting

  • Include calcium at varying concentrations (0-5 μM) to assess calcium-dependency

  • Use SCaMC-1 inhibitors or mutants as negative controls

Isolated Mitochondria Experiments:

  • Isolate intact mitochondria from cells with modified SCaMC-1 expression

  • Suspend mitochondria in medium containing appropriate respiratory substrates

  • Add defined calcium pulses to activate SCaMC-1

  • Measure adenine nucleotide transport using either:

    • Direct measurement of radiolabeled ATP uptake

    • Indirect assessment through altered calcium retention capacity

  • Confirm SCaMC-1 specificity using genetic knockdown/knockout controls

Analytical Considerations:

  • Account for matrix volume changes during experiments

  • Monitor membrane potential simultaneously to ensure mitochondrial integrity

  • Use phosphate-free media when assessing Pi transport

  • Consider SCaMC-1 paralogs that may compensate in knockout models

These methods can be combined with calcium flux measurements to correlate transport activity with calcium buffering capacity, providing comprehensive insight into SCaMC-1's physiological function.

What approaches should be used to investigate the interaction between SCaMC-1 and mPTP components?

Investigating the molecular interactions between SCaMC-1 and components of the mitochondrial permeability transition pore (mPTP) requires integrated approaches that capture both physical interactions and functional relationships:

Co-immunoprecipitation and Proximity Labeling:

  • Perform co-immunoprecipitation with antibodies against SCaMC-1 and known mPTP components (ANT, VDAC, Cyclophilin D)

  • Utilize BioID or APEX2 proximity labeling with SCaMC-1 fusion proteins to identify proteins in close proximity under various calcium conditions

  • Confirm interactions using reciprocal pull-downs and mass spectrometry identification

  • Map interaction domains using truncated protein constructs

Functional Interaction Analysis:

  • Assess how SCaMC-1 modulation affects CypD binding to potential mPTP components

  • Determine if SCaMC-1's effect on calcium retention capacity depends on CypD by using CypD inhibitors (cyclosporin A) or CypD knockout models

  • Investigate whether SCaMC-1 and ANT have synergistic or antagonistic effects on mPTP regulation

  • Measure adenine nucleotide binding to ANT in the presence or absence of functional SCaMC-1

Advanced Imaging Approaches:

  • Implement Förster Resonance Energy Transfer (FRET) with fluorescently tagged SCaMC-1 and mPTP components

  • Use super-resolution microscopy to visualize spatial relationships between SCaMC-1 and mPTP components

  • Employ split fluorescent protein complementation assays to verify protein-protein interactions in live cells

A critical consideration in these studies is that the mPTP is not a static entity but undergoes dynamic assembly. Therefore, interactions should be assessed under both basal conditions and during calcium stress when mPTP formation is triggered. Additionally, researchers should control for potential artifacts introduced by protein overexpression or tagging strategies.

How might targeting SCaMC-1 function provide therapeutic opportunities in cancer treatment?

The overexpression of SCaMC-1 in diverse cancer cells and its role in promoting cell survival provide compelling rationale for exploring it as a therapeutic target. Several strategic approaches warrant investigation:

Direct Inhibition Strategies:

  • Small molecule inhibitors that block the SCaMC-1 transport channel

  • Compounds that interfere with calcium binding to the N-terminal regulatory domain

  • Allosteric modulators that prevent conformational changes required for transport activity

These approaches could sensitize cancer cells to oxidative stress-induced cell death by reducing mitochondrial calcium buffering capacity and lowering the threshold for mPTP opening .

Combination Therapy Opportunities:

  • SCaMC-1 inhibition could synergize with:

    • ROS-generating chemotherapeutics (anthracyclines, platinum compounds)

    • Agents that increase cytosolic calcium (thapsigargin, ionomycin)

    • Metabolic inhibitors that increase cellular stress

  • Selective targeting of cancer cells with high SCaMC-1 expression, potentially sparing normal tissues

Potential Therapeutic Window:
The differential expression of SCaMC-1 between cancer and normal cells provides a theoretical therapeutic window. Comprehensive gene expression analysis shows SCaMC-1 overexpression is a general feature of transformed and cancer cells, while normal tissues typically express lower levels . This differential expression could allow selective targeting of malignant cells.

Preliminary evidence supporting this approach comes from studies showing that SCaMC-1 knockdown selectively sensitizes cells to oxidative stress-induced necrotic death without affecting sensitivity to apoptotic stimuli . This selectivity could potentially reduce side effects associated with conventional chemotherapy that induces both apoptosis and necrosis in normal tissues.

What are the current limitations in studying SCaMC-1 function and how might they be overcome?

Despite significant progress in understanding SCaMC-1 biology, several methodological and conceptual challenges persist:

Current Limitations and Proposed Solutions:

  • Limited Specificity of Available Antibodies and Inhibitors:

    • Challenge: Commercial antibodies often cross-react with SCaMC paralogs

    • Solution: Develop paralog-specific monoclonal antibodies through careful epitope selection

    • Alternative: Utilize CRISPR/Cas9 to tag endogenous SCaMC-1 with epitope tags or fluorescent proteins

  • Difficulty Measuring Transport Activity in Intact Cells:

    • Challenge: Directly measuring ATP-Mg/Pi transport across the inner mitochondrial membrane in living cells

    • Solution: Develop genetically-encoded fluorescent sensors for matrix ATP or Pi that can detect SCaMC-1-mediated transport

    • Alternative: Use stable isotope-labeled substrates with metabolomic analysis

  • Complex Regulation by Calcium and Other Factors:

    • Challenge: SCaMC-1 activity is regulated by calcium and potentially other signals in vivo

    • Solution: Implement optogenetic tools to precisely control cytosolic calcium levels while monitoring SCaMC-1 function

    • Alternative: Develop SCaMC-1 mutants with altered calcium sensitivity to dissect regulatory mechanisms

  • Redundancy Among SCaMC Paralogs:

    • Challenge: Functional compensation by other SCaMC paralogs can mask phenotypes

    • Solution: Generate cell lines or animal models with multiple SCaMC paralogs knocked out

    • Alternative: Develop paralog-specific inhibitors based on structural differences

  • Translation Between In Vitro and In Vivo Findings:

    • Challenge: Bridging the gap between reconstituted systems and physiological contexts

    • Solution: Develop tissue-specific and inducible SCaMC-1 knockout mouse models

    • Alternative: Use patient-derived cells with SCaMC-1 mutations to validate findings in human disease contexts

Addressing these limitations requires collaborative approaches combining expertise in structural biology, biochemistry, cell biology, and advanced imaging techniques. The development of new tools specifically tailored to study SCaMC-1 and related carriers will be crucial for advancing this field.

How do structural variations in SCaMC-1 across species inform our understanding of its function?

Comparative genomic and structural analysis of SCaMC-1 across species provides valuable insights into evolutionary conservation, functional domains, and species-specific adaptations:

Evolutionary Conservation Analysis:

SCaMC-1 belongs to the mitochondrial carrier family, which is highly conserved across eukaryotes. Key structural features show differential conservation patterns:

  • Transmembrane Domains: The six transmembrane α-helices forming the carrier domain show the highest degree of conservation, underscoring their critical role in creating the transport channel .

  • Calcium-Binding EF Hands: The N-terminal calcium-binding domain exhibits more variability, suggesting adaptation to species-specific calcium signaling requirements.

  • Substrate Specificity Determinants: Residues lining the substrate cavity show intermediate conservation, reflecting the maintenance of ATP-Mg/Pi transport while allowing for fine-tuning of substrate affinity.

Structure-Function Relationships:

The arginine residue at position 217 (affected in Fontaine syndrome) is highly conserved across species, indicating its fundamental importance to carrier function. Molecular dynamic simulation studies predict that mutations at this position (p.Arg217Cys or p.Arg217His) narrow the substrate cavity and disrupt transporter dynamics .

Comparative analysis across SCaMC paralogs and orthologs reveals key differences in:

  • Number and affinity of calcium-binding EF hands

  • Substrate selectivity determinants within the transport channel

  • Regulatory domains that may respond to signals beyond calcium

These structural variations likely contribute to the tissue-specific roles of different SCaMC paralogs and the adaptation of SCaMC-1 function to metabolic demands across species. Understanding these evolutionary patterns can guide the rational design of experiments to probe SCaMC-1 function and develop targeted modulators of its activity.

What technical considerations are important when using recombinant SCaMC-1 for structural studies?

Structural analysis of SCaMC-1 presents specific challenges due to its membrane protein nature and regulatory domains. Researchers should consider these technical aspects when designing structural biology experiments:

Protein Expression and Purification Considerations:

  • Construct Design:

    • Include the complete calcium-binding N-terminal domain for functional studies

    • Consider truncated constructs focusing on the carrier domain for crystallography

    • Position affinity tags (His, FLAG) to minimize interference with function

    • Engineer thermostabilizing mutations for enhanced stability during purification

  • Detergent Selection:

    • Mild detergents (DDM, LMNG) preserve structural integrity

    • Test multiple detergents for optimal extraction efficiency and stability

    • Consider detergent screening approaches (SEC-based or thermal stability assays)

    • Evaluate native nanodiscs or SMALPs for maintaining lipid environment

Structural Determination Approaches:

  • X-ray Crystallography:

    • Vapor diffusion and lipidic cubic phase methods for membrane proteins

    • Consider co-crystallization with substrates or calcium to capture different conformational states

    • Use surface entropy reduction to enhance crystal packing

  • Cryo-Electron Microscopy:

    • Potentially superior for capturing conformational states

    • Consider GraFix method to stabilize protein complexes

    • Utilize new generation direct electron detectors for high-resolution data collection

  • Integrative Structural Biology:

    • Combine lower-resolution structural data with computational modeling

    • Use hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Implement molecular dynamics simulations to understand calcium-induced conformational changes

Critical Quality Control Metrics:

  • Size-exclusion chromatography profiles (monodispersity assessment)

  • Thermal stability assays (differential scanning fluorimetry)

  • Functional validation through transport assays in proteoliposomes

  • Calcium-binding assessment using isothermal titration calorimetry

These technical considerations should be combined with careful experimental design to capture SCaMC-1 in physiologically relevant conformational states, particularly addressing how calcium binding to the N-terminal domain activates the transport function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.