Recombinant Bovine CD9 antigen (CD9)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine CD9 Antigen

Recombinant Bovine CD9 antigen (CD9) is a genetically engineered form of the bovine Cluster of Differentiation 9 protein, a member of the tetraspanin family. CD9 is a 24–26 kDa transmembrane glycoprotein with four hydrophobic domains, widely expressed in endothelial cells, platelets, leukocytes, and neural tissues . Its recombinant form is produced using in vitro expression systems (e.g., HEK293, CHO, or E. coli) to enable standardized study of its structural and functional properties .

Functional Roles in Bovine Physiology

CD9 regulates diverse cellular processes in bovines:

  • Cell Adhesion and Migration: Modulates integrin-dependent endothelial cell migration during vascular repair .

  • Exosome Biogenesis: A key marker of extracellular vesicles, influencing intercellular communication .

  • Ocular Function: Highly expressed in bovine corneal and ciliary epithelial cells, suggesting roles in aqueous humor secretion .

  • Immune Regulation: Associates with MHC class II molecules on dendritic cells, enhancing T-cell activation .

Cloning and Tissue Distribution

  • A bovine CD9 cDNA clone (226 amino acids) was isolated from ocular ciliary epithelium, with mRNA detected in cornea, retina, and lens .

  • Elevated CD9 expression correlates with reduced metastatic potential in bovine-derived cancer cell lines, mirroring findings in human studies .

Antibody Development and Applications

Antibody CloneHostApplicationsCross-Reactivity
LT86A MouseFlow cytometryBovine, Caprine, Ovine, Human
MM2/57 MouseIHC, IF, WBHuman, Porcine (weak)
2310.9 MouseWB, IF, Flow cytometryBroad mammalian species

These tools enable precise detection of bovine CD9 in research models .

Applications in Biomedical Research

  • Cancer Studies: CD9 suppression in bovine cell lines reduces invasiveness by altering plasma membrane dynamics (e.g., loss of lamellipodia) .

  • Reproductive Biology: Critical for sperm-egg fusion in bovines, via interactions with integrin α6β1 .

  • Renal Disease Models: CD9 upregulation in parietal epithelial cells correlates with glomerular injury, suggesting therapeutic targeting potential .

Challenges and Future Directions

While recombinant bovine CD9 is pivotal for studying transmembrane signaling, challenges include:

  • Species-Specific Variability: Functional differences between bovine and human CD9 in exosome cargo sorting .

  • Antibody Specificity: Cross-reactivity issues with non-target species (e.g., porcine) .

Ongoing research focuses on engineering monovalent antibodies to mitigate platelet aggregation side effects during therapeutic applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
CD9; CD9 antigen; CD antigen CD9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-226
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
CD9
Target Protein Sequence
PVKGGTKCIKYLLFGFNFIFWLAGIAVLSVGLWLRFDSQTKSIFEQENNDSSFYTGVYIL IGAGALMMLVGFLGCCGAVQESQCMLGLFFSFLLVIFAIEVAAAIWGYSHKEEVIKEVQK FYEDTYNKLKNKDEPQRETLKAIHIALDCCGLTGVPEQFLTDTCPPKNLIDSLKTRPCPE AIDEIFRSKFHIIGAVGIGIAVVMIFGMVFSMILCCAIRRNRDMV
Uniprot No.

Target Background

Function
CD9 is an integral membrane protein associated with integrins, regulating diverse processes including sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Expressed on the oocyte cell surface, it plays a crucial role in sperm-egg fusion, potentially by organizing membrane protein complexes and influencing membrane morphology necessary for fusion. In myoblasts, it interacts with CD81 and PTGFRN, inhibiting myotube fusion during muscle regeneration. In macrophages, it associates with CD81 and β1 and β2 integrins, preventing fusion into multinucleated giant cells responsible for ingesting complement-opsonized large particles. It also inhibits fusion between mononuclear cell progenitors into osteoclasts involved in bone resorption. CD9 functions as a receptor for PSG17 and is involved in platelet activation, aggregation, and paranodal junction formation. It further participates in cell adhesion, cell motility, and tumor metastasis.
Gene References Into Functions
  1. Studies demonstrate that vitrification/warming procedures significantly reduce CD9 mRNA and protein expression levels and alter CD9 distribution in bovine oocytes. PMID: 23572435
  2. Bovine retinal microvascular endothelial cells express tetraspanin family members, including CD9, which demonstrates a role in cell migration and adhesion. PMID: 17912457
  3. CD9 on mature bovine oocytes participates in sperm-oocyte interaction during fertilization. PMID: 19293563
Database Links

KEGG: bta:280746

STRING: 9913.ENSBTAP00000019643

UniGene: Bt.2573

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Secreted, extracellular exosome.
Tissue Specificity
Detected in cornea, and at low levels in neuroretina and ciliary epithelium cells.

Q&A

What is bovine CD9 and what are its key structural features?

Bovine CD9 is a tetraspanin protein family member with four transmembrane domains. It functions as a type IV transmembrane glycoprotein with important roles in cellular interactions and signaling pathways. Structurally, CD9 contains four transmembrane domains with two extracellular loops, similar to CD9 in other species such as humans and mice . The protein plays crucial roles in cell-cell adhesion and signal transduction through interactions with low molecular weight GTP binding proteins. As with CD9 in other species, bovine CD9 likely contains conserved cysteine residues in the second extracellular loop that are critical for its tertiary structure and function .

Where is CD9 typically expressed in bovine tissues?

Based on expression patterns in other species, bovine CD9 would be expected to be expressed on multiple cell types including leukocytes, platelets, and endothelial cells. In immune cells, CD9 is likely expressed on early B cells, eosinophils, basophils, and activated T cells . It may also be a major component of bovine platelet cell surfaces. Additionally, CD9 expression would be expected in reproductive tissues given its role in gamete fusion in mammals. The expression pattern can be confirmed through techniques like immunohistochemistry, flow cytometry, and Western blotting using specific antibodies against bovine CD9 .

How does recombinant bovine CD9 differ from native bovine CD9?

Recombinant bovine CD9 is produced through expression systems (typically bacterial, insect, or mammalian cells) rather than being isolated directly from bovine tissues. While the amino acid sequence should be identical to native bovine CD9, there may be differences in post-translational modifications depending on the expression system used. Particularly, glycosylation patterns may differ between recombinant and native proteins. Recombinant bovine CD9 is typically engineered with affinity tags (such as His-tags) to facilitate purification, which are not present in the native protein . These modifications can occasionally affect protein folding or function, necessitating validation of recombinant protein activity against native standards through functional assays .

What are the recommended storage conditions for recombinant bovine CD9?

Optimal storage conditions for recombinant bovine CD9 typically include maintaining the protein at -80°C for long-term storage, with aliquoting recommended to avoid repeated freeze-thaw cycles that can degrade protein integrity. For short-term storage (1-2 weeks), 4°C may be suitable if the protein is in an appropriate buffer containing stabilizers. The buffer composition is critical and often includes PBS at pH 7.4 with possible additions of glycerol (15-25%) to prevent freezing damage, and protease inhibitors to prevent degradation . Quality control testing should include periodic assessment of protein integrity through methods such as SDS-PAGE and functional activity assays after various storage periods to establish optimal storage protocols for specific research applications .

What are the most effective methods for detecting bovine CD9 in tissue samples?

For detecting bovine CD9 in tissue samples, multiple complementary approaches are recommended. Immunohistochemistry (IHC) using validated anti-CD9 antibodies provides spatial information about CD9 distribution within tissues, while Western blotting offers quantitative protein expression data. For IHC, paraffin-embedded sections typically require antigen retrieval using citrate buffer (pH 6.0) under high pressure . Blocking with 10% normal serum for 30 minutes at room temperature followed by primary antibody incubation (1:100 dilution in 1% BSA) overnight at 4°C typically yields optimal results .

Flow cytometry is particularly useful for detecting CD9 on cell surfaces, with antibody concentrations requiring optimization for bovine samples. For exosome research, CD9 detection using ELISA or bead-based flow cytometry methods can be employed. Quantitative PCR can complement protein detection by measuring CD9 mRNA expression. Cross-reactivity between bovine CD9 antibodies and CD9 from other species should be carefully evaluated and documented to ensure specificity .

How can I validate the specificity of antibodies for bovine CD9?

Validating antibody specificity for bovine CD9 requires a multi-step approach. Begin with Western blotting to confirm the antibody recognizes a protein of the expected molecular weight (~24-25 kDa for CD9). Include positive controls (tissue known to express CD9) and negative controls (tissue with minimal CD9 expression or CD9 knockout samples) . Peptide competition assays, where the antibody is pre-incubated with purified recombinant bovine CD9, should abolish specific staining if the antibody is truly specific.

Immunoprecipitation followed by mass spectrometry can conclusively identify the pulled-down protein as CD9. For cell-based assays, siRNA knockdown of CD9 in bovine cells should reduce antibody binding proportionally to knockdown efficiency. Cross-reactivity testing against other tetraspanin family members (especially CD63 and CD81) is essential to ensure the antibody doesn't recognize these related proteins. Flow cytometry with dual staining using two different anti-CD9 antibodies targeting distinct epitopes can further confirm specificity .

What is the recommended protocol for using recombinant bovine CD9 as a standard in quantitative assays?

For using recombinant bovine CD9 as a quantitative standard, begin with accurate protein quantification using multiple methods (BCA or Bradford assay, amino acid analysis, and absorbance at 280nm) to establish precise concentration. Prepare a master stock at 1 mg/mL in PBS with 10% glycerol, aliquot to avoid freeze-thaw cycles, and store at -80°C. For standard curves, create fresh dilutions from a single thawed aliquot in the same buffer used for your samples.

A 7-point standard curve with 2-fold or 3-fold serial dilutions typically provides good coverage of the dynamic range. For ELISA or other immunoassays, the recommended range is 6.1 × 10⁴ to 6.1 × 10⁷ particles/mL based on similar assays for other tetraspanins . Always run standards in triplicate to calculate intra-assay coefficient of variation (CV) which should be <10%. Inter-assay CV can be monitored by including a reference standard across multiple plates or experimental days. Validate that the recombinant protein behaves similarly to native CD9 by comparing dilution linearity between recombinant standards and endogenous CD9 in biological samples .

How does bovine CD9 compare functionally to CD9 from other species like human and mouse?

Functional conservation can be assessed through complementation studies, where bovine CD9 is expressed in CD9-deficient cells from other species to determine if it rescues function. For example, the ability of bovine CD9 to restore fertilization capacity in CD9-knockout mouse oocytes would indicate functional conservation in gamete fusion. Cross-species immunoprecipitation studies can identify whether bovine CD9 interacts with the same partner proteins as human or mouse CD9. The pattern of tissue expression may also show species-specific variations that correlate with physiological differences between bovine and other mammals .

What are the optimal conditions for studying CD9-mediated protein interactions in bovine cells?

Studying CD9-mediated protein interactions in bovine cells requires preserving the integrity of tetraspanin-enriched microdomains (TEMs). Cell lysis should use mild detergents like CHAPS (1%) or Brij-97 (1%) rather than harsh detergents like SDS or Triton X-100 which disrupt tetraspanin interactions. Lysis buffers should include protease inhibitors, phosphatase inhibitors, and be maintained at 4°C throughout processing .

For co-immunoprecipitation experiments, antibodies against bovine CD9 should be conjugated to agarose or magnetic beads using methods that maintain the antibody's native conformation. Pre-clearing lysates with protein A/G beads reduces nonspecific binding. For crosslinking studies to capture transient interactions, cell-permeable crosslinkers like DSP (dithiobis[succinimidyl propionate]) at 0.5-2 mM for 30 minutes at room temperature can be used prior to lysis. Mass spectrometry analysis of co-immunoprecipitated proteins should be paired with reverse co-immunoprecipitation experiments to confirm interactions. Blue native PAGE is an alternative approach that can preserve protein complexes for downstream analysis of interacting partners .

What techniques can be used to quantitatively measure bovine CD9 expression on extracellular vesicles?

Quantitative measurement of bovine CD9 on extracellular vesicles (EVs) requires a combination of specialized techniques. Surface Plasmon Resonance (SPR) and Quartz Crystal Microbalance with Dissipation (QCM-D) offer highly sensitive methods for CD9 quantification . For SPR, immobilize anti-CD9 antibodies on sensor chips using EDC/NHS chemistry, with careful optimization of antibody orientation. Parameters should include: contact time (360s), stabilization (300s), and flow rate (5 μL/min) for antibody immobilization, followed by EV interaction settings of contact time (90s), dissociation time (300s), and flow rate (5 μL/min) .

For QCM-D analysis, gold sensors modified with CSH monolayer provide optimal antibody orientation. EV samples require precise dilution optimization, with the best statistical parameters typically achieved at 10⁵-fold dilution for bovine samples . The linear detection range for similar tetraspanin assays is 6.1 × 10⁴ to 6.1 × 10⁷ particles/mL, with limits of detection around 0.6-2.5 × 10⁴ particles/mL. Nanoparticle Tracking Analysis (NTA) should be used in parallel to correlate CD9 signal with actual EV concentration, addressing the heterogeneity of CD9 expression on different EV subpopulations .

How can I establish a bovine cell line stably expressing recombinant CD9 for functional studies?

Establishing a bovine cell line stably expressing recombinant CD9 begins with designing an expression construct containing the bovine CD9 coding sequence, ideally codon-optimized for bovine cells. Include an appropriate promoter (CMV for strong expression or native CD9 promoter for physiological levels) and a selection marker (neomycin/G418, puromycin, or hygromycin resistance). A fluorescent protein tag (GFP or mCherry) separated by a flexible linker or a small epitope tag (FLAG, HA) can facilitate detection without disrupting function .

For transfection into bovine cells, electroporation typically yields higher efficiency than chemical methods. Nucleofection protocols specifically optimized for primary bovine cells should be considered if working with primary rather than immortalized cells. After transfection, selection pressure should be applied gradually, starting with a lower concentration of selection agent and increasing over 1-2 weeks. Once stable pools are established, limiting dilution cloning will generate monoclonal populations, which should be screened for CD9 expression levels using flow cytometry and Western blotting .

Functional validation should include rescue experiments if using CD9-knockdown or knockout cells, assessment of cell migration, proliferation, and adhesion phenotypes, as well as evaluation of CD9's role in exosome production or cellular response to specific stimuli relevant to the research question .

Why might Western blotting for bovine CD9 show multiple bands or unexpected molecular weights?

Multiple bands or unexpected molecular weights in Western blotting for bovine CD9 can result from several factors. Post-translational modifications, particularly glycosylation, can cause CD9 to migrate at higher molecular weights than the predicted ~24-25 kDa. Different glycosylation patterns may produce multiple bands representing differentially modified forms of CD9 . Incomplete denaturation of tetraspanin-enriched microdomains can result in high molecular weight complexes resistant to standard SDS-PAGE conditions. This can be addressed by more stringent sample preparation, including longer heating times (10 minutes) at 95°C or inclusion of additional denaturants .

Proteolytic degradation during sample preparation might generate lower molecular weight fragments. Ensure complete protease inhibitor cocktails are used in all buffers. Different antibodies may recognize different epitopes with varying accessibility depending on protein folding and denaturation conditions. If using a tagged recombinant CD9, confirm whether the antibody recognizes the tag or the CD9 portion . Alternative splicing of bovine CD9 mRNA could potentially generate multiple protein isoforms with different molecular weights, though this would need to be confirmed by sequencing .

What are the common pitfalls when isolating CD9-positive extracellular vesicles from bovine samples?

Isolating CD9-positive extracellular vesicles (EVs) from bovine samples presents several challenges. Co-isolation of protein aggregates or lipoprotein particles that may non-specifically bind anti-CD9 antibodies is a common issue. Pre-clearing samples by centrifugation at 20,000g for 30 minutes followed by filtration through 0.22 μm filters can reduce these contaminants .

Antibody cross-reactivity between bovine CD9 and other tetraspanins (CD63, CD81) may lead to isolation of mixed EV populations. Validation of antibody specificity against bovine proteins is essential, as antibodies raised against human or mouse CD9 may have different affinities for bovine CD9 . Sample dilution is critical - as shown in QCM-D and SPR analyses, optimal detection occurs at specific dilutions (10⁴-10⁵ fold), with very concentrated or dilute samples giving unreliable results .

EV isolation using antibody-based methods may selectively capture only a subset of EVs with sufficient CD9 expression, potentially biasing downstream analyses. Complementary isolation methods (ultracentrifugation, size exclusion chromatography) should be compared. Finally, biological fluids like milk or serum contain factors that may interfere with antibody binding to CD9. Optimization of washing buffers and blocking conditions for each specific bovine fluid type is necessary for reliable CD9-positive EV isolation .

How is recombinant bovine CD9 being used in veterinary vaccine development?

Recombinant bovine CD9 has emerging applications in veterinary vaccine development, particularly for bovine respiratory diseases and reproductive health. As CD9 plays roles in cell-cell interactions and immune responses, it can potentially be utilized as an immunomodulatory component or adjuvant in vaccine formulations . In experimental vaccines for Bovine Respiratory Syncytial Virus (BRSV) and other pathogens, CD9-containing platforms may enhance immune response through improved antigen presentation or lymphocyte activation .

The incorporation of CD9 into virus-like particles (VLPs) or nanoparticle vaccines represents a promising direction, as CD9-enriched membranes can serve as anchoring platforms for viral antigens, potentially improving their presentation to the immune system. Additionally, CD9's role in exosome biology suggests exosome-based vaccines incorporating bovine CD9 could deliver antigens more effectively to antigen-presenting cells .

Research into CD9's interactions with bovine pathogens, particularly those involving fusion events during infection, may reveal new targets for vaccine design. Monitoring CD9-specific immune responses following vaccination could provide biomarkers for vaccine efficacy evaluation. Quantitative measurements using techniques like SPR and QCM-D could be valuable for standardizing CD9-based vaccine components and quality control .

What computational methods are most effective for predicting protein-protein interactions involving bovine CD9?

For predicting protein-protein interactions (PPIs) involving bovine CD9, multiple computational approaches should be integrated. Homology-based prediction leverages the evolutionary conservation between bovine CD9 and better-studied orthologs from human or mouse, where experimental PPI data is more abundant. Tools like Interologous Interaction Database (I2D) and STRING can transfer known interactions from other species to bovine CD9 based on sequence similarity .

Structural modeling approaches begin with generating a 3D model of bovine CD9 using homology modeling tools like SWISS-MODEL or AlphaFold. These models can then be used in molecular docking simulations with potential interaction partners using ClusPro, HADDOCK, or Rosetta. Special attention should be paid to the large extracellular loop of CD9, which mediates many key interactions .

Machine learning methods integrating multiple features (sequence, structure, co-expression data, etc.) can predict novel interactions. Ensemble approaches combining predictions from multiple algorithms typically outperform individual methods. Validation of computational predictions should include co-immunoprecipitation experiments, proximity ligation assays, or FRET/BRET techniques to confirm physical interactions in bovine cells .

What is the current understanding of CD9's role in bovine reproductive biology and fertility?

CD9 plays critical roles in bovine reproductive biology, particularly in fertilization. Based on studies in other mammals, bovine CD9 is likely essential for sperm-egg fusion during fertilization. In females, CD9 is expressed on the oocyte membrane where it facilitates sperm adhesion and fusion through interactions with sperm surface proteins like IZUMO1 .

In male reproduction, CD9 is present on sperm and in the epididymal fluid, often associated with small extracellular vesicles that may transfer proteins to sperm during maturation. CD9-positive EVs in seminal plasma potentially contribute to sperm function and storage stability, with implications for artificial insemination and cryopreservation protocols in cattle breeding .

CD9 expression levels in bovine gametes correlate with fertility outcomes, suggesting potential use as a biomarker for oocyte or sperm quality assessment. In assisted reproductive technologies for cattle, monitoring CD9 could help select optimal gametes. For in vitro embryo production, understanding CD9's role in early embryonic development may improve culture conditions and embryo quality. Antibodies against bovine CD9 or recombinant CD9 proteins may find applications in fertility enhancement or contraceptive development for cattle breeding management .

What are the key analytical parameters for detecting bovine CD9 using surface-based biosensors?

Analytical ParameterSurface Plasmon Resonance (SPR)Quartz Crystal Microbalance with Dissipation (QCM-D)
Linear regression equationResponse = f(CD9 concentration)Δf = 1.75 log C<sub>EVs</sub> – 6.03 (for anti-CD9)
R<sup>2</sup> value0.9988 (for anti-CD9)0.9991 (for anti-CD9)
Dynamic range6.1 × 10<sup>4</sup> to 6.1 × 10<sup>7</sup> particles·mL<sup>-1</sup>6.1 × 10<sup>4</sup> to 6.1 × 10<sup>7</sup> particles·mL<sup>-1</sup>
Limit of Detection (LOD)7.8 × 10<sup>3</sup> particles·mL<sup>-1</sup>0.60 × 10<sup>4</sup> particles·mL<sup>-1</sup>
Limit of Quantification (LOQ)2.6 × 10<sup>4</sup> particles·mL<sup>-1</sup>2.0 × 10<sup>4</sup> particles·mL<sup>-1</sup>
Optimal sample dilution10<sup>5</sup>-fold10<sup>5</sup>-fold
Antibody immobilization parametersContact time: 360s; Stabilization: 300s; Flow rate: 5 μL·min<sup>-1</sup>CSH monolayer modification; EDC/NHS activation (40mM/10mM) for 30 min
EV interaction parametersContact time: 90s; Dissociation: 300s; Flow rate: 5 μL·min<sup>-1</sup>Flow rate: 50 μL·min<sup>-1</sup>; Temperature: 21°C
Regeneration protocolTwo-step: 10mM glycine-HCl pH 1.5 followed by 50mM NaOHSimilar protocol recommended for bovine applications

These analytical parameters provide a framework for developing robust assays for bovine CD9 detection in research applications . The high R<sup>2</sup> values indicate excellent linearity within the specified dynamic ranges. For accurate quantification, samples should be diluted approximately 10<sup>5</sup>-fold to fall within the optimal detection range of both SPR and QCM-D techniques .

What are the validated antibodies and their applications for bovine CD9 research?

Antibody TypeClone/Catalog NumberSpecies ReactivityValidated ApplicationsRecommended DilutionsNotes for Bovine Applications
MonoclonalAnti-CD9 (Clone 2310.9)Human, potential cross-reactivity with bovineFlow Cytometry, IF, Western BlotFC: 1:100-1:200, WB: 1:1000, IF: 1:100Requires validation for bovine specificity
PolyclonalCSB-PA004969KA01HUHuman, Mouse, Rat, potential bovine cross-reactivityELISA, WB, IHCELISA: 1:1000, WB: 1:500-1:2000, IHC: 1:100Test for bovine specificity
Recombinant Monoclonal24MS04.9 (mouse reactive)Mouse, potential bovine cross-reactivityFlow CytometryFC: 1:100Test for bovine cross-reactivity
PolyclonalCSB-PA001486Human, Mouse, RatWB, IHC, IF, ELISAWB: 1:500, IHC: 1:200, IF: 1:100, ELISA: 1:1000Requires validation for bovine applications
Conjugated AntibodiesCSB-PA10559C0Rb (FITC)HumanFlow CytometryFC: 1:50-1:100May require additional validation for bovine samples
BiotinylatedCSB-PA10559D0RbHumanELISAELISA: 1:200-1:1000Secondary detection system with streptavidin must be optimized

The table outlines commercially available antibodies that may be applicable to bovine CD9 research . Due to the conserved nature of CD9 across mammalian species, these antibodies may show cross-reactivity with bovine CD9, but validation is essential before use in critical experiments. For bovine-specific applications, preliminary testing should include Western blotting against bovine tissue lysates known to express CD9, comparative staining with multiple antibodies, and negative controls .

What are the major challenges in developing bovine-specific CD9 reagents?

Developing bovine-specific CD9 reagents faces several challenges. Limited sequence information and annotation of the bovine genome compared to human or mouse models complicates primer and antibody design. Post-translational modifications of bovine CD9 may differ from other species, affecting antibody recognition and protein function. The complex membrane topology of CD9 with multiple transmembrane domains makes recombinant expression challenging, as proper folding is difficult to achieve in bacterial systems .

Species cross-reactivity issues arise where antibodies designed for human or mouse CD9 may show variable or unpredictable reactivity with bovine CD9 despite sequence homology. The limited commercial market for bovine-specific reagents reduces economic incentives for companies to develop dedicated bovine CD9 antibodies or expression systems .

Technical barriers include difficulties in expressing full-length membrane proteins with correct folding and modifications. Future directions should focus on developing bovine-specific monoclonal antibodies using recombinant bovine CD9 as immunogen, creating bovine cell lines with CRISPR-edited tagged CD9 for reagent validation, and establishing standardized protocols for quality control of bovine CD9 reagents across laboratories .

How might single-cell analysis technologies advance our understanding of CD9 function in bovine tissues?

Single-cell analysis technologies offer unprecedented opportunities to understand CD9 function in bovine tissues. Single-cell RNA sequencing (scRNA-seq) can reveal cell type-specific expression patterns of CD9 and co-expressed genes across diverse bovine tissues, identifying cell populations where CD9 might have specialized functions. This approach can uncover regulatory networks controlling CD9 expression during development or disease states .

Mass cytometry (CyTOF) using metal-tagged antibodies against CD9 and other markers allows simultaneous quantification of dozens of proteins at the single-cell level, revealing how CD9 expression correlates with cell phenotype and function in complex bovine tissues. Imaging mass cytometry extends this to spatial contexts, showing CD9 localization relative to tissue architecture .

Single-cell ATAC-seq can identify regulatory elements controlling bovine CD9 expression in different cell types, while spatial transcriptomics preserves tissue context while measuring CD9 mRNA levels. For functional studies, high-content imaging of CD9-GFP fusion proteins in live bovine cells can track CD9 dynamics during cellular processes like exosome formation or cell migration .

Integration of these technologies with computational approaches will likely reveal previously unknown functions of CD9 in bovine physiology and pathology, potentially identifying new biomarkers or therapeutic targets for veterinary applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.