Recombinant Bovine Ceramide synthase 2 (CERS2)

What is Ceramide Synthase 2 (CERS2) and what is its primary function?

CERS2 is an enzyme belonging to the ceramide synthase family that primarily catalyzes the synthesis of very-long-chain ceramides (C20-C26). It functions in the de novo sphingolipid biosynthetic pathway by acylating sphinganine to produce dihydroceramides, which are subsequently converted to ceramides. The enzyme shows specificity for very-long-chain fatty acyl-CoAs as substrates, distinguishing it from other ceramide synthase family members.

CERS2 contains the catalytic Lag1p domain, which is essential for its enzymatic activity and substrate specificity . The enzyme is particularly important for maintaining the balance between very-long-chain sphingolipids (VLSLs) and long-chain sphingolipids (LSLs), which has significant implications for cellular homeostasis and function .

How is CERS2 expressed across different tissues and cell types?

CERS2 shows a distinctive tissue distribution pattern with high expression in specific cell types:

RNA sequencing has indicated that CERS2 is the most abundant ceramide synthase in single human β-cells and islets of non-diabetic donors . While these findings are from human studies, similar expression patterns are likely in bovine tissues given the conserved nature of sphingolipid metabolism across mammals.

What are the key structural domains of CERS2 protein?

The CERS2 protein contains several crucial structural elements:

The full amino acid sequence of human CERS2 (as a reference) is:
MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIV
RYFFELVVATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLS
RQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIDK
PWFYDMKKVWEGYPIYSTIPSQYWYYMIELSFTTRPCNGGCLLVMQSEDAHK
LGGRYGMLVHWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAG
TLIMALHDLIYYTLPKAVBCSSRLKKFFPTFDLLDSLFEWAKGQLQNPQWPI
KSSYDYITWIEQKCRFPGFEGVYEMADSNGNEALGRILLGSLFLITTTSTHK
MGCHSSDYLLESAKMFNYAGWCQALFNLTSPPIIQQMTKCNNIFINPLVGPT
CMGQIYALAVYLLNCDKEEKKCLAQGTLLVLSLAVFIITRGSRLRQFVRSMH
VHYFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLHHECIKMAFVYHFWRY
LILRMAHKFITGKLVEDERSDREETESSEGEAAAGGAKSRPLANGHPILNNN
HRKND

The Lag1p domain, which contains Exon 8, is particularly important as it is responsible for the catalytic activity of CERS2. Studies have shown that alternative splicing affecting Exon 8 can significantly impact the enzyme's functionality .

What methods are commonly employed to detect and quantify CERS2 expression?

Researchers typically use the following techniques to detect and measure CERS2:

When working with bovine CERS2, it's important to validate antibody cross-reactivity with bovine proteins, as most commercially available antibodies are developed against human or mouse antigens. For recombinant protein detection, tag-specific antibodies (e.g., against C-Myc/DDK tags) can be used as described in commercial recombinant protein productions .

What experimental considerations are necessary when working with recombinant bovine CERS2?

When working with recombinant bovine CERS2, researchers should consider:

• Storage and stability: Recombinant CERS2 protein should be stored at -80°C and is typically stable for 12 months under proper storage conditions. Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity .

• Buffer composition: Optimal formulation includes 25 mM Tris.HCl (pH 7.3), 100 mM glycine, and 10% glycerol to maintain protein stability .

• Concentration determination: Protein concentration can be accurately determined using microplate BCA method, with typical preparations yielding >50 μg/mL .

• Purity assessment: SDS-PAGE with Coomassie blue staining is recommended to confirm protein purity, which should typically be >80% for experimental use .

• Membrane protein considerations: As CERS2 is a membrane-associated enzyme, maintaining proper folding and activity requires specialized handling approaches different from soluble proteins.

How does alternative splicing affect CERS2 function and what are the implications for researchers?

Research has revealed that CERS2 can undergo a significant alternative splicing event involving Exon 8, which corresponds to part of the catalytic Lag1p domain. This has important functional consequences:

Studies have demonstrated that CERS2 undergoes a unique cassette exon event specifically in Luminal B subtype tumors, where Exon 8 is skipped. This splicing event has been validated in Luminal B cancer cells compared to normal epithelial cells and in patient-derived tumor tissues compared to matched normal tissues .

The alternative splicing of CERS2 significantly impacts survival outcomes in Luminal B patients, serving as a poor prognostic factor. When Exon 8 is skipped, the resulting protein shows reduced catalytic activity and altered substrate specificity, leading to decreased levels of very-long-chain ceramides. This alteration affects cancer cell proliferation and migration .

Researchers working with recombinant bovine CERS2 should be aware of these potential splicing variants, particularly when studying functional aspects of the enzyme or when using it as a model for human disease states.

What approaches are most effective for studying CERS2 knockout or knockdown effects?

Several approaches have proven effective for studying CERS2 deficiency:

CRISPR/Cas9 has been successfully employed to knock out CERS2 in rat pancreatic β-cell line Ins1E, which led to expected reductions in very-long-chain sphingolipid levels . This approach allows for robust analysis of CERS2 function in cultured cells.

For in vivo studies, conditional knockout models have proven valuable. For example, researchers created CerS2 ΔBKO mice lacking CERS2 specifically in β-cells by inter-crossing a conditional CerS2 mouse strain with Ins1-Cre mice. This approach avoided the complications associated with global CerS2 knockout, which causes multiple abnormalities .

Pharmacological inhibition with fumonisin (1-5 μM) has been used to block ceramide synthase activity, providing a method for acute inhibition in experimental settings .

How can researchers effectively analyze sphingolipid profile changes in CERS2-related studies?

Lipidomic analysis is essential for understanding CERS2 function:

To effectively analyze sphingolipid changes in CERS2 studies:

• Sample preparation: Careful lipid extraction is critical, using established protocols for cellular, tissue, or subcellular fractions like phagosomes .

• Targeted analysis: Focus on specific sphingolipid species, particularly the very-long-chain ceramides (C20-C26) primarily produced by CERS2 .

• Ratio analysis: Calculate the ratio between long-chain (e.g., C16:0) and very-long-chain (e.g., C24:1) sphingolipids as a key parameter. Lipidomic analyses of CerS2 ΔBKO islets have shown a strong decrease in VLSLs and increase in the C16:0/C24:1 ratio of Cer, HexCer and SM .

• Multiple sphingolipid classes: Analyze not just ceramides but also downstream metabolites like sphingomyelins and hexosylceramides to understand the broader impact .

• Controls: Include appropriate controls, such as samples from wild-type tissues or cells treated with vehicle (e.g., DMSO) rather than inhibitors .

What is the role of CERS2 in immunological processes and how can it be studied?

CERS2 has significant impacts on immune function:

Studies have demonstrated that CerS2 deficiency causes reduced Th2 response and alleviates ovalbumin-induced asthma, suggesting an important role for CerS2 and its products in immune regulation .

To study these effects:

• Isolate CD4+ T cells from wild-type and CerS2-deficient models

• Measure secretory capacities of cytokines (particularly Th2 cytokine IL-4 and Th17 cytokine IL-17)

• Analyze TCR-stimulated responses using anti-CD3/anti-CD28 antibodies

• Assess expression of master regulators like Gata3 (Th2) and RORγt (Th17)

• For phagocytosis studies, analyze sphingolipid content in phagosomes at different maturation stages

How do cellular processes involving membrane dynamics relate to CERS2 function?

CERS2-produced very-long-chain ceramides play crucial roles in membrane dynamics:

Research has revealed that VLC fatty acid-containing ceramides increase during phagosomal maturation, while sphingosine decreases. CerS2 likely controls the flux of sphingolipid metabolism during this process, as pharmacological inhibition with fumonisin reverses these changes .

Studies in β-cells have shown that CERS2 ablation causes highly selective changes in cellular processes, affecting only 0.4% of proteins at a fold change of ≥1.5. Among these, Pcsk1 (a crucial enzyme in proinsulin-to-insulin conversion) was decreased by approximately 50% in CerS2-deficient cells, highlighting the specific downstream effects of CERS2 activity .

What expression systems are optimal for producing recombinant bovine CERS2?

Selecting an appropriate expression system is critical for obtaining functional recombinant CERS2:

HEK293T cells have been successfully used for CERS2 expression, where cells are transfected with CERS2 cDNA clone . This mammalian system provides proper folding and post-translational modifications essential for CERS2 function.

For recombinant bovine CERS2 production, consider these methodological steps:

• Clone bovine CERS2 cDNA into appropriate expression vector with affinity tag (C-Myc/DDK tags have proven effective)

• Transfect HEK293T cells using optimized transfection reagents

• Select stable cell lines if needed for continuous production

• Optimize culture conditions for protein expression

• Verify protein expression by SDS-PAGE and Western blotting

What purification strategies yield the highest activity for recombinant CERS2?

Purifying membrane proteins like CERS2 requires specialized approaches:

When purifying recombinant bovine CERS2:

• Use detergents that maintain membrane protein structure (e.g., digitonin, DDM)

• Include protease inhibitors during extraction and purification

• Maintain cold temperature throughout the process

• Consider including lipids in buffers to maintain native environment

• Concentrate to >50 μg/mL as determined by microplate BCA method

What are the most reliable methods for assessing CERS2 enzymatic activity?

Several approaches can be used to measure CERS2 activity:

For in vitro activity assays:

• Combine purified CERS2 with sphinganine/sphingosine and very-long-chain acyl-CoAs

• Incubate under optimal conditions (pH, temperature, cofactors)

• Extract lipids and analyze ceramide production by LC-MS/MS

• Compare with appropriate controls (enzyme-free, heat-inactivated)

For cellular assays:

• Overexpress wild-type or mutant CERS2 in appropriate cell lines

• Extract cellular lipids and analyze sphingolipid profiles

• Compare changes in very-long-chain ceramide levels

• Correlate with functional outcomes (e.g., cell proliferation, migration)

How can researchers effectively inhibit CERS2 activity for functional studies?

Several approaches can inhibit CERS2 for experimental purposes:

Fumonisin treatment has been demonstrated to potently inhibit ceramide formation without activating cells or inducing apoptosis at appropriate concentrations (1-5 μM for 4 hours) . This approach provides a rapid method for acute CERS2 inhibition.

For genetic approaches, CRISPR/Cas9 has been successfully used to knock out CERS2 in cell lines, while conditional knockout strategies have enabled tissue-specific ablation in animal models . These approaches allow for more specific and complete inhibition of CERS2 activity.

To confirm effective inhibition, researchers should:

• Verify reduction in target protein by Western blotting

• Analyze sphingolipid profiles to confirm decreased very-long-chain ceramides

• Measure phenotypic outcomes relevant to the research question

• Include appropriate controls (scrambled siRNA, Cre-negative animals)

What experimental controls are essential when working with recombinant CERS2?

Robust experimental design requires appropriate controls:

When designing experiments with recombinant bovine CERS2:

• Expression verification: Confirm protein expression using SDS-PAGE and Western blotting with either CERS2-specific antibodies or tag-specific antibodies (e.g., anti-C-Myc/DDK) .

• Functional validation: Measure enzymatic activity using in vitro assays with appropriate substrates, focusing on very-long-chain acyl-CoAs that are preferential substrates for CERS2.

• Specificity controls: Compare activity with different acyl-CoA chain lengths to confirm the expected preference for very-long-chain substrates.

• Negative controls: Include enzymatically inactive CERS2 mutants (e.g., mutations in the Lag1p domain) or empty vector controls.

• Pharmacological validation: Use known ceramide synthase inhibitors like fumonisin (1-5 μM) to confirm that observed effects are due to enzymatic activity .

• Alternative splicing consideration: When studying functional aspects, be aware of potential alternative splicing affecting Exon 8, which can significantly impact enzymatic activity .