Recombinant Bovine Ceramide synthase 4 (CERS4)

Shipped with Ice Packs
In Stock

Description

Functional Role in Sphingolipid Metabolism

CERS4 is a key enzyme in the sphingolipid biosynthesis pathway:

  • Catalytic Activity: Transfers acyl chains (C18–C22) to sphinganine, forming dihydroceramides, which are later modified into ceramides .

  • Fatty Acid Selectivity: Exhibits specificity for long-chain fatty acids (C18–C22), distinguishing it from other ceramide synthases like CerS1 (C18) or CerS5/6 (C14–C16) .

Cancer Pathogenesis

  • Breast Cancer: Chronic overexpression of CERS4 in MCF-7 cells promotes chemoresistance, epithelial–mesenchymal transition (EMT), and activation of oncogenic pathways (NF-κB, Akt/mTOR) .

  • Liver Cancer: Silencing CERS4 in HepG2 and Huh7 cells reduces proliferation, induces G0/G1 cell cycle arrest, and suppresses tumor growth in vivo via NF-κB pathway modulation .

  • Colorectal Cancer: Reduced CERS4 expression correlates with KRAS mutations and increased vascular invasion .

Dermatological Conditions

  • Atopic Dermatitis (AD): Elevated CERS4 expression in AD-affected skin correlates with higher levels of shorter ceramide species (e.g., C34-Cer[NS]) and impaired skin barrier function .

Therapeutic Implications

  • Targeting CERS4:

    • In breast cancer, CERS4 knockdown reverses chemoresistance and downregulates ABC transporters (ABCB1, ABCC1) .

    • In liver cancer, CERS4 suppression reduces tumor weight and volume in murine models .

  • Diagnostic Potential: High CERS4 expression in malignant tissues suggests utility as a biomarker for liver and breast cancers .

Comparative Insights Across Species

Studies on human and murine CERS4 provide a framework for understanding bovine CERS4:

  • Conserved Pathways: The role of CERS4 in sphingolipid metabolism and oncogenesis is evolutionarily conserved .

  • Structural Homology: Bovine CERS4 shares >85% amino acid sequence identity with human CERS4, implying similar enzymatic properties .

Knowledge Gaps and Future Directions

  • Bovine-Specific Studies: Limited direct research on recombinant bovine CERS4 exists; most data are extrapolated from human/murine models.

  • Mechanistic Studies: Further work is needed to clarify how bovine CERS4 interacts with lipid rafts or signaling pathways in bovine-specific contexts.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CERS4; LASS4; Ceramide synthase 4; CerS4; LAG1 longevity assurance homolog 4; Sphingosine N-acyltransferase CERS4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
CERS4
Target Protein Sequence
MWSSLNDWLWNERLWLPANISWAQLEDHDGLVFPHPQDTLMAVPLALALVVVRFTFERFV ALPLSRWLGVRNQIRRPADPNATLEKHYLMKGREPTESQMNLLATQCGLTLRQTQCWFRR RRNQDRPCLTKKFCESSWKFVFYLCCFVCGTMVLYHESWLWTPVKCWENYPHQPLKPGLY HWYLLELSFYISLLMTLPFDTKRKDFKEQVIHHFVTIILISFSYSLNLLRIGSLVLLLHD SADYLLEASKLFNYMHWRRMCDTLFIIFSLVFFYTRLVLFPTRILYTTFFESIGNFSPFF GYYFLNILLVILQLLHVFWSWLILCMIYSFIKKGQMEKDVRSDVEELDSSDGEAAEECPQ MKNGAAQRPGAAPTDGPRSRAAGRMVNRHTPAT
Uniprot No.

Target Background

Function
Ceramide synthase catalyzes the formation of ceramide from sphinganine and acyl-CoA substrates. It exhibits high selectivity for long and very-long chains (C18:0-C22:0) as acyl donors.
Database Links

KEGG: bta:505233

STRING: 9913.ENSBTAP00000004459

UniGene: Bt.2268

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic function of CERS4 in sphingolipid metabolism?

CERS4 is one of six mammalian ceramide synthases that catalyzes the formation of ceramides by creating an amide bond between a sphingoid base and a fatty acyl-coenzyme A . This reaction is a critical step in the de novo synthesis pathway of sphingolipids. CERS4 predominantly generates ceramides with specific acyl chain lengths, contributing to the diversity of the ceramide pool in cells. Understanding this basic function is essential for interpreting experimental results in sphingolipid research.

How is CERS4 expression distributed across different bovine tissues?

CERS4 shows tissue-specific expression patterns. Based on research findings from analogous systems, CERS4 is predominantly expressed in epithelial tissues, particularly in sebaceous glands of the skin and in suprabasal epidermal layers . In the context of pathological conditions such as cancer, CERS4 has been found to be highly expressed in liver cancer tissues . When designing experiments involving bovine CERS4, researchers should consider these tissue-specific expression patterns to ensure physiological relevance.

What are the structural features of bovine CERS4 that distinguish it from other ceramide synthases?

Bovine CERS4, like other ceramide synthases, contains a TLC (TRAM-LAG-CLN8) domain responsible for its catalytic activity. CERS4 has specific structural features that determine its substrate specificity for fatty acyl-CoAs of particular chain lengths. While detailed crystallographic data for bovine CERS4 is limited, comparative analysis with other mammalian CERS proteins suggests the presence of multiple transmembrane domains and potential glycosylation sites that may regulate its activity and localization . These structural features should be considered when designing expression constructs for recombinant production.

What post-translational modifications occur in bovine CERS4?

Based on studies of ceramide synthases, CERS4 likely undergoes N-linked glycosylation, which may be critical for its enzymatic activity . Drawing parallels from CERS6 research, where glycosylation at Asn18 is required for activity, researchers should monitor potential glycosylation sites in bovine CERS4 when expressing the recombinant protein . Other post-translational modifications may include phosphorylation events that could regulate enzyme activity in response to cellular signaling.

What expression systems are most effective for producing recombinant bovine CERS4?

For recombinant bovine CERS4 expression, mammalian cell systems such as HEK293 or CHO cells are generally preferred over bacterial systems due to the need for proper protein folding and post-translational modifications, particularly glycosylation. Based on ceramide synthase research protocols, researchers should consider using vectors with strong promoters (like CMV) and appropriate tags (His, FLAG, or HA) that do not interfere with enzyme activity . When designing expression constructs, it's crucial to preserve potential glycosylation sites, as these appear essential for activity based on studies of related ceramide synthases.

How can researchers accurately measure bovine CERS4 enzymatic activity in vitro?

The most robust method for measuring bovine CERS4 activity involves sphingosine-based substrate labeling followed by lipid extraction and analysis by liquid chromatography-mass spectrometry (LC-MS). Specifically:

  • Prepare microsomes from cells expressing recombinant CERS4

  • Incubate with sphingosine (or labeled sphingosine like 17C-sphingosine) and specific acyl-CoAs

  • Extract lipids using chloroform/methanol extraction

  • Analyze ceramide production by LC-MS

  • Quantify specific ceramide species based on acyl chain length

This methodology allows for precise quantification of CERS4 activity toward different acyl-CoA substrates . Researchers should include appropriate controls, including heat-inactivated enzyme preparations and assays with competitive inhibitors.

What are the optimal conditions for storing recombinant bovine CERS4 to maintain activity?

Recombinant CERS4, being a membrane-associated enzyme, requires careful storage conditions to maintain activity. Based on protocols for similar enzymes, purified CERS4 should be stored in buffer containing 20-25% glycerol, 1-2 mM DTT (to maintain reduced cysteine residues), and appropriate protease inhibitors. Storage at -80°C in small aliquots is recommended to avoid freeze-thaw cycles. For short-term storage (1-2 weeks), 4°C may be suitable if the protein is kept in a detergent-containing buffer that maintains its native conformation . Activity assays should be performed after storage to confirm enzyme stability.

How can researchers generate CERS4 knockout models to study its function?

For generating CERS4 knockout models, CRISPR-Cas9 gene editing has proven effective based on studies with other ceramide synthases . When designing guide RNAs, target conserved regions within exons that encode catalytic domains to ensure complete loss of function. For validation of knockout models:

  • Confirm gene disruption by DNA sequencing

  • Verify protein absence by Western blotting with specific antibodies

  • Demonstrate functional deficiency through ceramide profiling by LC-MS

  • Assess phenotypic changes in cellular or animal models

In mouse models, CERS4 knockout resulted in altered lipid composition of sebum and subsequent phenotypic changes . Similar approaches can be adapted for bovine cell lines or models.

How does CERS4 contribute to cellular stress responses and apoptotic signaling?

CERS4-generated ceramides participate in cellular stress response pathways, potentially through modulation of the NF-κB signaling pathway . Research indicates that CERS4 knockdown affects expression of genes involved in this pathway, including Ikbkg and Tank . To investigate these relationships:

  • Employ recombinant bovine CERS4 in controlled expression systems

  • Induce cellular stress with specific stimuli (e.g., TNF-α, radiation)

  • Monitor ceramide generation and downstream signaling events

  • Assess effects of CERS4 inhibition or overexpression on apoptotic markers

Researchers should use phospho-specific antibodies to track activation of stress-responsive kinases and transcription factors, alongside ceramide measurements to establish cause-effect relationships.

What role does bovine CERS4 play in cancer cell proliferation and tumor development?

Studies have demonstrated that CERS4 is highly expressed in liver cancer tissues, and its silencing significantly suppresses cancer cell proliferation both in vitro and in vivo . When investigating bovine CERS4 in cancer contexts:

  • Compare CERS4 expression levels between normal and cancerous bovine tissues

  • Assess proliferation rates following CERS4 knockdown using lentiviral shRNA approaches

  • Evaluate colony formation capacity in vitro using crystal violet staining

  • Measure tumor growth parameters in xenograft models

Data indicates that silencing CERS4 reduces tumor weight and volume in mouse models, suggesting it may be a potential therapeutic target . Researchers should combine functional assays with molecular analyses to elucidate underlying mechanisms.

How does glycosylation status affect CERS4 activity and trafficking?

While direct data on CERS4 glycosylation is limited, research on other ceramide synthases (CERS6) indicates that glycosylation at specific asparagine residues is crucial for enzymatic activity . To investigate this for bovine CERS4:

  • Identify potential N-glycosylation sites using bioinformatic tools

  • Generate site-directed mutants (e.g., asparagine to alanine substitutions)

  • Express wild-type and mutant proteins in appropriate systems

  • Compare enzymatic activities using LC-MS-based assays

  • Assess protein localization using subcellular fractionation or immunofluorescence

Treating cells with glycosylation inhibitors (e.g., tunicamycin) or glycosidases (Endo-H, PNGase-F) can provide additional insights into how glycosylation affects CERS4 function and trafficking .

How do CERS4-generated ceramides interact with other signaling pathways?

CERS4-generated ceramides may influence multiple signaling pathways beyond NF-κB. Drawing parallels from CERS6 research, potential interactions may occur with GSK3β, AKT, JNK, and STAT3 signaling pathways . To investigate these interactions:

  • Express recombinant bovine CERS4 in appropriate cellular models

  • Manipulate CERS4 activity through overexpression or knockdown

  • Monitor pathway-specific phosphorylation events by Western blotting

  • Perform rescue experiments with specific ceramide species

  • Use pathway-specific inhibitors to establish directionality of effects

Researchers should design time-course experiments to differentiate between direct and indirect effects of CERS4-generated ceramides on signaling pathways.

How can researchers address inconsistent activity of recombinant bovine CERS4?

Inconsistent enzymatic activity of recombinant CERS4 may result from several factors:

  • Post-translational modifications: Ensure expression systems support proper glycosylation. Consider analyzing protein glycosylation status using glycosidase treatments and Western blotting .

  • Protein folding and stability: Optimize buffer conditions, including detergent type and concentration for membrane protein solubilization.

  • Substrate availability: Ensure adequate delivery of sphingoid base and acyl-CoA substrates, which may require optimization of detergent micelles or liposome preparations.

  • Enzyme oligomerization: Consider that ceramide synthases can form homodimers and heterodimers that modulate activity . Analyze oligomeric state using native gel electrophoresis or size exclusion chromatography.

Maintaining consistent expression conditions and careful quality control of purified protein are essential for reproducible activity measurements.

How should researchers interpret discrepancies between in vitro and in vivo CERS4 activity data?

Discrepancies between in vitro and in vivo CERS4 activity may arise from several sources:

  • Substrate accessibility: In vivo, compartmentalization may limit substrate availability, while in vitro assays provide optimal substrate concentrations.

  • Regulatory factors: Cellular regulatory proteins or lipid environments may modulate CERS4 activity in vivo but are absent in purified systems.

  • Post-translational modifications: Dynamic modifications in cells may not be recapitulated in recombinant systems.

To address these discrepancies, researchers should:

  • Compare in vitro activity with cellular ceramide synthesis using metabolic labeling approaches

  • Assess CERS4 activity in isolated cellular fractions under near-native conditions

  • Consider using permeabilized cell systems as an intermediate between purified enzyme and intact cells

What controls are essential when analyzing sphingolipid composition in CERS4 research?

When analyzing sphingolipid composition in CERS4 research, several controls are critical:

  • Internal standards: Include deuterated or odd-chain sphingolipid standards for each major lipid class to normalize extraction efficiency and instrument response.

  • Biological controls: Compare wild-type, CERS4-overexpressing, and CERS4-knockout/knockdown samples processed in parallel.

  • Analytical controls: Monitor retention time shifts and mass accuracy using quality control samples throughout analytical runs.

  • Pathway controls: Include inhibitors of sphingolipid metabolism (e.g., myriocin for de novo synthesis) to differentiate between direct CERS4 effects and compensatory pathway changes.

  • Specificity controls: Assess levels of ceramide species with different acyl chain lengths to confirm CERS4's specific contribution to the ceramide pool .

How can single-cell analysis techniques be applied to study CERS4 function in heterogeneous tissues?

Recent technological advances allow for sphingolipid analysis at the single-cell level, opening new possibilities for studying CERS4 function:

  • Single-cell sphingolipidomics: Combining fluorescence-activated cell sorting with sensitive mass spectrometry enables ceramide profiling in specific cell populations.

  • Spatial transcriptomics: Technologies like Visium or MERFISH can map CERS4 expression patterns within tissues, correlating with cell types and microenvironmental factors.

  • Reporter systems: Development of fluorescent reporters for CERS4 activity would allow real-time monitoring in living cells.

  • CyTOF with lipid detection: Mass cytometry adaptations could potentially allow simultaneous detection of proteins and lipids at single-cell resolution.

These approaches would be particularly valuable for studying CERS4 in tissues with heterogeneous cell populations, such as skin, where CERS4 shows cell-type-specific expression in sebaceous glands .

What is the potential of CERS4 as a therapeutic target for liver cancer?

Research findings indicate that CERS4 is highly expressed in liver cancer tissues, and its silencing significantly suppresses cancer cell proliferation and tumor development . This suggests potential therapeutic applications:

  • Small molecule inhibitors: Design of specific CERS4 inhibitors based on structural insights and substrate specificity.

  • Gene therapy approaches: Targeted delivery of CERS4 shRNA or siRNA to liver cancer cells.

  • Combination therapies: Exploration of synergistic effects between CERS4 inhibition and conventional chemotherapeutics.

Future research should address:

  • Specificity of CERS4 inhibition versus other ceramide synthases

  • Biomarker development to identify patients most likely to respond to CERS4-targeted therapies

  • Mechanisms of resistance to CERS4 inhibition in cancer cells

How do CERS4 and other ceramide synthases coordinate their functions in maintaining cellular sphingolipid homeostasis?

The coordination between different ceramide synthases represents an emerging area of research:

  • Physical interactions: Recent evidence suggests ceramide synthases can form heterodimers with altered substrate preferences and activities .

  • Transcriptional coordination: Investigation of common transcription factors and regulatory elements controlling expression of multiple ceramide synthases.

  • Compensatory mechanisms: When one ceramide synthase is deficient, others may be upregulated to maintain essential ceramide pools.

  • Subcellular co-localization: Different ceramide synthases may concentrate in specific ER subdomains, facilitating coordination or specialized functions.

Researchers investigating bovine CERS4 should consider these potential interactions and examine co-expression patterns with other ceramide synthases in tissues of interest.

What role does CERS4 play in lipid raft formation and membrane microdomain organization?

CERS4-generated ceramides contribute to membrane structure and organization:

  • Domain-specific incorporation: Ceramides with specific acyl chain lengths (generated by CERS4) may preferentially incorporate into certain membrane microdomains.

  • Lipid raft composition: CERS4 deficiency alters lipid composition, potentially affecting lipid raft structure and function .

  • Protein-lipid interactions: CERS4-generated ceramides may influence recruitment and function of membrane proteins in specialized microdomains.

Future research directions should include:

  • Super-resolution microscopy to visualize membrane domain alterations in CERS4-deficient cells

  • Lipidomic analysis of isolated membrane microdomains

  • Investigation of receptor clustering and signaling in relation to CERS4-dependent ceramide production

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.