Recombinant Bovine Chloride channel CLIC-like protein 1 (CLCC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
CLCC1; Chloride channel CLIC-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-542
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
HDDEWIDPTDMLNYDAASGRMRKSQVKYGISEKEEVNPDLSCANELSECYNRLDSLTYKI DECEKQKRKDYESQSNPVFRRYLNKILIETKKLGLPDENKHDMHYDAEIILKRQTLLEIQ KFLSGEDWKPGALDDALSDILINFKFHDFETWKWRFEEFFGVDPYNVFMVLLCLLCIVAL VATELWTYVRWYTQLKRVFFISFLISLGWNWMYLYKLAFAQHQAEVAKMEPLNNVCAEKM NWSGSLWEWLRSSWTYKDDPCQKYYELLLVNPIWLVPPTKALAVTFTNFVTEPLKHVGKG AGEFIKALMKEIPVLLHIPVLIIMALAVLSFCYGAGKSVNMLRHVGGPEREAPQALQAGE RRRQQKIDYRPHGGAGDADFYYRGQISPIEQGPNDNTYEGRRDVLRERDVGLRFQTGNKS PEVLRPFDLQEAEAREHPKVVPGLKSPNLESKPREMGEIPGESTPTESSTESSQPAKPVS GQKVSEGVEGCPAVEKAQLRTDAAGGPEEGSTCSPASTAVEVCG
Uniprot No.

Target Background

Function
Functions as a chloride ion channel and plays a role in retinal development.
Database Links
Protein Families
Chloride channel MCLC family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.