Recombinant Bovine Chloride intracellular channel protein 4 (CLIC4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CLIC4; Chloride intracellular channel protein 4; Intracellular chloride ion channel protein p64H1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-253
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
CLIC4
Target Protein Sequence
ALSMPLNGLKEEDKEPIIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKR KPADLQNLAPGTHPPFITFNNEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDI FAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDG NEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVE IAYSDVAKRLTK
Uniprot No.

Target Background

Function
Inserts into cell membranes to form chloride ion channels.
Database Links
Protein Families
Chloride channel CLIC family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and typical properties of recombinant CLIC4?

Recombinant CLIC4 has a predicted molecular mass of 18.4 kDa, though its accurate molecular mass in gel electrophoresis is approximately 22 kDa . This difference may reflect post-translational modifications or conformational properties. The protein has an isoelectric point of 6.6 .

While CLIC4 is known as a chloride channel protein, its functions appear much broader. Notably, purified soluble recombinant CLIC4 demonstrates the ability to insert itself into artificial lipid membranes and conduct chloride ion currents, supporting its classification as a channel protein .

Where is CLIC4 typically localized in cells, and does this change under different conditions?

  • Cell membrane

  • Nucleus

  • Mitochondria

  • Microvilli (MV)

  • Cell-cell junctions

  • Centrosomes

  • Large dense core granules

CLIC4 localization changes dramatically in response to stimuli. For example, in macrophages stimulated with lipopolysaccharide (LPS), CLIC4 shows marked increases in membrane fraction after 6 hours, becoming especially prominent at 24 hours. Similarly, nuclear localization increases in a time-dependent manner following LPS stimulation .

What are the recommended storage and reconstitution protocols for recombinant CLIC4?

Recombinant CLIC4 should be reconstituted in 10mM PBS (pH 7.4) to a concentration of 0.1-1.0 mg/mL. It is important not to vortex the solution during reconstitution .

For storage, avoid repeated freeze/thaw cycles. Short-term storage (up to one month) can be at 2-8°C. For long-term storage, aliquot the reconstituted protein and store at -80°C for up to 12 months .

Stability testing through accelerated thermal degradation (incubation at 37°C for 48h) has shown a loss rate of less than 5% within the expiration date when stored under appropriate conditions .

What methods are effective for studying CLIC4 expression changes in response to stimuli?

Several complementary techniques have proven effective for monitoring CLIC4 expression and localization changes:

  • RT-qPCR: To measure mRNA expression changes. Studies have shown significant increases in CLIC4 mRNA expression at 2, 4, and 8 hours after LPS stimulation in BMDMs and RAW 264.7 macrophages .

  • Western blotting: To quantify protein levels in whole cell lysates or subcellular fractions. This technique has demonstrated that while total CLIC4 protein may show modest changes, subcellular redistribution can be substantial .

  • Subcellular fractionation: To isolate cytosolic, membrane, and nuclear fractions for comparative analysis of CLIC4 distribution. This approach revealed dramatic translocation of CLIC4 to membrane and nuclear compartments following LPS stimulation .

  • Confocal microscopy: For visualization of CLIC4 localization in intact cells. This technique has confirmed increased expression after stimulation but may have limitations in detecting membrane insertion due to potential changes in antigen presentation .

How does CLIC4 contribute to epithelial morphogenesis and tubulogenesis?

CLIC4 plays a critical role in epithelial morphogenesis through multiple mechanisms:

  • Apical membrane biogenesis: CLIC4 is enriched in the apical microvilli of epithelial cells, where it supports proper microvillus formation. Silencing CLIC4 results in abnormally short and "compact" microvilli, indicating its importance in apical structure development .

  • Lumen formation: In 3D culture models, CLIC4 is expressed on early endosomes, recycling endosomes, and apical transport carriers before reaching its steady-state apical membrane localization in mature lumen. Suppression of CLIC4 impairs apical vesicle coalescence and central lumen formation .

  • Endosomal trafficking: CLIC4 selectively modulates retromer-mediated apical transport by negatively regulating the formation of branched actin on early endosomes, which is crucial for proper lumen development .

  • Interaction with cytoskeletal regulators: CLIC4 suppression phenotypes can be rescued by Rab8 and Cdc42, suggesting it functions within this regulatory pathway for apical exocytosis .

These functions appear to be distinct from traditional chloride channel activities, highlighting CLIC4's multifunctional nature in development.

What phenotypes are observed in CLIC4 knockout or knockdown models?

CLIC4 deficiency produces multiple phenotypes across various experimental models:

In vivo models:

  • CLIC4-null mouse embryos exhibit impaired renal tubulogenesis

  • Adult CLIC4-null proximal tubules display aberrant dilation

  • CLIC4-null mice are protected from LPS-induced death and show reduced serum levels of inflammatory cytokines

  • CLIC4-deficient mice are impaired in their ability to clear Listeria monocytogenes infection

  • Silencing CLIC4 in retinal pigment epithelium (RPE) is sufficient to induce retinal detachment and retinal atrophy

In vitro models:

  • CLIC4 knockdown in macrophages results in significant reduction of pro-IL-1β mRNA expression after LPS treatment

  • CLIC4 suppression in MDCK 3D cultures causes impaired apical vesicle coalescence and central lumen formation

  • RPE cells with CLIC4 silencing show abnormally short and "compact" microvilli

Importantly, these phenotypes cannot be rescued by ectopic expression of related proteins such as ezrin, demonstrating specificity of CLIC4 function .

How does CLIC4 function in inflammatory responses and innate immunity?

CLIC4 plays a significant role in modulating innate immune responses:

  • LPS-induced expression: Endogenous CLIC4 levels are significantly elevated in multiple organs (brain, heart, lung, kidney, liver, spleen) after LPS injection in mice . In macrophages, LPS stimulation causes increased CLIC4 mRNA expression .

  • Pro-inflammatory cytokine production: Stable macrophage lines overexpressing CLIC4 produce higher levels of TNF, IL-6, IL-12, and CCL5 than control cells when exposed to LPS .

  • Bacterial clearance: CLIC4-deficient mice show impaired ability to clear Listeria monocytogenes infection, with their macrophages producing fewer inflammatory cytokines and chemokines compared to wild-type controls .

  • LPS priming: Knockdown of CLIC4 results in significant reduction of pro-IL-1β mRNA expression after LPS treatment, indicating that CLIC4 modulates the LPS priming step in macrophages .

  • Subcellular translocation: LPS stimulation triggers dramatic redistribution of CLIC4 to membrane and nuclear compartments in macrophages, suggesting activation-dependent functions .

This evidence positions CLIC4 as an important regulator of inflammatory responses, with potential implications for both infectious diseases and inflammatory conditions.

What techniques are most effective for studying CLIC4 function in experimental settings?

Multiple complementary approaches have proven valuable for investigating CLIC4 function:

Genetic manipulation techniques:

  • siRNA knockdown: Effective for transient suppression of CLIC4 expression to study acute effects on cellular processes .

  • Short hairpin RNA (shRNA): Useful for more sustained CLIC4 suppression, particularly when combined with fluorescent reporters (e.g., CLIC4-sh/HcRed or CLIC4-sh/mGFP) to identify targeted cells .

  • CLIC4-null mice: Valuable for studying systemic effects of CLIC4 absence in development and disease models .

  • Rescue experiments: Critical for validating specificity of knockdown phenotypes by co-expressing knockdown-resistant CLIC4 variants (e.g., dog CLIC4 cDNA with rat-specific shRNA) .

Functional assays:

  • 3D culture models: MDCK 3D cultures allow visualization of lumen formation processes dependent on CLIC4 .

  • Subcellular fractionation: Essential for tracking CLIC4 translocation between cytosolic, membrane, and nuclear compartments .

  • Confocal microscopy: Enables visualization of CLIC4 localization and morphological effects of CLIC4 manipulation .

  • Bacterial infection models: Useful for assessing CLIC4's role in immune responses to pathogens like Listeria monocytogenes .

  • In vitro channel activity: Reconstitution of purified CLIC4 in artificial lipid membranes can assess ion conductance properties .

How does CLIC4 interact with membrane trafficking machinery and the cytoskeleton?

CLIC4 serves as a critical regulator of membrane trafficking and cytoskeletal organization:

  • Retromer-mediated trafficking: CLIC4 selectively modulates retromer-mediated apical transport by negatively regulating the formation of branched actin on early endosomes .

  • Rab8-Cdc42 pathway: CLIC4 suppression phenotypes can be rescued by Rab8 and Cdc42, indicating CLIC4 functions within this regulatory pathway for apical exocytosis and lumen formation .

  • Apical vesicle transport: During lumen formation, CLIC4 is expressed on early endosomes, recycling endosomes, and apical transport carriers before reaching its steady-state apical membrane localization .

  • Microvillus morphogenesis: CLIC4 is essential for proper microvillus development, though this function appears distinct from that of ezrin, another critical microvillus protein .

  • Endolysosomal biogenesis: CLIC4 plays an important role in endolysosomal formation, particularly in proximal tubule epithelial cells .

These interactions position CLIC4 as a multifunctional protein that coordinates membrane dynamics with cytoskeletal organization to support complex cellular processes including polarization, vesicle trafficking, and morphogenesis.

How conserved is CLIC4 across species, and what are the implications for using animal models?

CLIC4 shows evolutionary conservation across mammalian species, making various animal models relevant for CLIC4 research:

  • Structural homology: CLIC4 is a mammalian homologue of EXC-4, whose mutation is associated with cystic excretory canals in nematodes, suggesting evolutionary conservation of function in tubulogenesis .

  • Cross-species rescue: Dog CLIC4 cDNA can rescue phenotypes caused by knockdown of rat CLIC4, demonstrating functional conservation across mammalian species .

  • Model systems: Various experimental models have been successfully used to study CLIC4, including:

    • Mouse models (CLIC4-null mice)

    • Rat models (in vivo transfection studies)

    • Cell lines from different species (RAW 264.7, J774, MDCK)

  • Expression patterns: CLIC4 shows similar tissue-specific enrichment across species, such as in proximal tubule epithelial cells in both developing and developed kidneys .

This conservation suggests that findings from animal models are likely applicable to bovine systems, though species-specific differences in regulation or interaction partners may exist and should be considered when translating findings across species.

What is known about the relationship between CLIC4 and other CLIC family proteins?

Although the search results provide limited direct comparisons between CLIC4 and other CLIC family members, some information can be extracted:

  • Distinct expression patterns: CLIC1 and CLIC4 show different expression responses to LPS stimulation. While CLIC4 mRNA expression increases significantly after LPS stimulation, CLIC1 mRNA levels remain relatively unchanged .

  • Functional overlap: Both CLIC1 and CLIC4 appear to modulate the LPS priming step in macrophages, as knockdown of either protein results in reduced pro-IL-1β mRNA expression .

  • Similar translocation patterns: Both CLIC1 and CLIC4 show increased membrane and nuclear localization following LPS stimulation, suggesting similar regulatory mechanisms or functional roles in response to inflammatory stimuli .

  • Specificity in antibody detection: The search results mention an affinity-purified anti-CLIC4 antibody that did not cross-react with other CLIC proteins, indicating structural differences that allow specific detection .

For comprehensive studies of bovine CLIC4, researchers should consider potential functional redundancy or compensatory mechanisms involving other CLIC family members, particularly in knockout or knockdown experimental designs.

What are common challenges in working with recombinant CLIC4 and how can they be addressed?

Based on the available information, researchers may encounter several challenges when working with recombinant CLIC4:

  • Protein stability: Avoid repeated freeze/thaw cycles as they can compromise protein integrity. Instead, reconstitute and aliquot the protein, storing at -80°C for long-term use .

  • Reconstitution considerations: Reconstitute in 10mM PBS (pH 7.4) to a concentration of 0.1-1.0 mg/mL, and importantly, do not vortex during reconstitution as this may affect protein structure or function .

  • Antibody specificity: Ensure antibodies used for detection are specific to CLIC4 and do not cross-react with other CLIC family proteins. The literature mentions using affinity-purified antibodies that have been validated for specificity .

  • Subcellular localization detection: Changes in protein conformation during membrane insertion may affect antigen presentation and complicate detection by some antibodies. Consider using multiple detection methods or epitope tags to overcome this limitation .

  • Expression system selection: The recombinant CLIC4 described in the search results was expressed in a prokaryotic system (E. coli), which may lack post-translational modifications present in the native protein. Consider the implications for functional studies .

  • Functional assays: When assessing channel activity of recombinant CLIC4, artificial lipid reconstitution may be necessary, as the protein needs to insert into membranes to function as an ion channel .

How can researchers validate the specificity of CLIC4 knockdown phenotypes?

To ensure observed phenotypes are specifically due to CLIC4 deficiency rather than off-target effects, several validation approaches have been successfully employed:

  • Rescue experiments: Co-expression of knockdown-resistant CLIC4 variants (such as CLIC4 from another species not targeted by the species-specific shRNA) has been used to rescue phenotypes, confirming their specificity to CLIC4 loss .

  • Multiple knockdown strategies: Using different siRNA or shRNA sequences targeting distinct regions of CLIC4 can help confirm that consistent phenotypes are due to CLIC4 depletion rather than off-target effects .

  • Negative controls: Include appropriate controls such as scrambled shRNA sequences to demonstrate that the observed effects are specific to CLIC4 targeting .

  • Comparison with knockout models: When possible, compare knockdown phenotypes with those observed in CLIC4 knockout animals to corroborate findings across different experimental systems .

  • Non-redundant functions: Testing whether related proteins (e.g., ezrin for microvillus formation) can rescue CLIC4 knockdown phenotypes helps establish the specificity and non-redundant functions of CLIC4 .

  • Molecular markers: Assess the effects of CLIC4 knockdown on markers known to be affected (e.g., pro-IL-1β expression) versus those that remain unchanged (e.g., NLRP3 expression), providing further evidence of specificity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.