Recombinant Bovine Chloride intracellular channel protein 5 (CLIC5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type during ordering for preferential development.
Synonyms
CLIC5; Chloride intracellular channel protein 5; Chlorine channel protein p64
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-437
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
CLIC5
Target Protein Sequence
MNDENYSTTIYNRVQTERVYEDSDPAENGGPLYDEVHEDVRREDNLYVNELENQEYDSVA VYPVGRQGRTSASLQPETGEYVLPDEPYSKAQDPHPGEPTADEDISLEELLSPTKDHQSD SEEPQASDPEEPQASDPEEPQGPDPEEPQENGNEMEADLPSPSSFTIQNSRAFSTREISP TSYSADDVSEGNESASASPEINLFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVD LKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPRLAAKHRESNTAG IDIFVKFSAYIKNTKQQSNAALERGLTKALKKLDDYLNTPLPEEIDADTRGDDEKGSRRK FLDGDELTLADCNLLPKLHVVKIVAKKYRNYDFPAEMTGLWRYLKNAYARDEFTNTCAAD SEIELAYADVAKRLSRS
Uniprot No.

Target Background

Function
Chloride intracellular channel protein 5 (CLIC5) is crucial for normal hearing, essential for stereocilia formation in the inner ear and proper development of the organ of Corti. It inserts into cell membranes to form relatively non-selective ion channels, potentially transporting chloride ions. CLIC5 may also regulate transepithelial ion absorption and secretion. Furthermore, it plays a role in developing and maintaining the glomerular endothelial cell and podocyte architecture, and is involved in lens suture formation, vital for maintaining the optical properties of the lens.
Gene References Into Functions
  1. CLIC5 colocalizes with ezrin and podocalyxin in podocytes and is required for the development and maintenance of proper glomerular endothelial cell and podocyte architecture. PMID: 20335315
Database Links

KEGG: bta:281696

STRING: 9913.ENSBTAP00000013537

UniGene: Bt.194

Protein Families
Chloride channel CLIC family
Subcellular Location
Golgi apparatus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. Membrane; Single-pass membrane protein. Apical cell membrane; Single-pass membrane protein. Cytoplasm.
Tissue Specificity
Expressed in most tissues. Higher levels found in kidney, heart, skeletal muscle, T84 and PANC-1 cells.

Q&A

Basic Research Questions

  • What is the structure and function of CLIC5 protein?

    CLIC5 belongs to a family of ion channels with six members identified to date. Unlike conventional channel proteins, CLIC5 can uniquely transition between soluble and membrane-associated conformations.

    CLIC5 functions include:

    • Membrane fusion (acting as a fusogen)

    • Interaction with cytoskeletal components, particularly actin

    • Regulation of myoblast differentiation and skeletal muscle regeneration

    • Maintenance of stereocilia integrity in hair cells

    The protein structure consists of a conserved C-terminal core domain that shares 52-76% identity with other CLIC family members. Notably, residues 1-105 in CLIC5 are responsible for membrane insertion and binding to partner proteins like biglycan (BGN) .

  • How is CLIC5 expressed in different tissue types?

    CLIC5 demonstrates distinct tissue-specific expression patterns:

    Tissue/Cell TypeExpression LevelIsoformKey Functions
    Skeletal muscleHighCLIC5AMyoblast differentiation, muscle regeneration
    Inner ear hair cellsVery highCLIC5AStereocilia maintenance
    Kidney glomeruliHigh (~800-fold enrichment)CLIC5APodocyte architecture, filtration barrier
    Pronephric tubulesModerateCLIC5BCiliogenesis
    Placental microvilliHighCLIC5Cytoskeletal organization

    The gene encodes two major isoforms: CLIC5A (shorter) and CLIC5B (longer, with additional N-terminal domain). These display differential expression patterns, with CLIC5A predominantly in glomeruli and hair cells, while CLIC5B is expressed in pronephric tubules, gut, and liver .

  • What experimental systems are commonly used to study CLIC5 function?

    Several experimental models are utilized to investigate CLIC5:

    • Cell culture systems: C2C12 myoblasts for studying differentiation, HEK293T cells for protein-protein interactions

    • Animal models: Conditional knockout mice (CLIC5-Flox;Myf5-Cre for muscle studies), jitterbug (jbg) mice with spontaneous CLIC5 mutation for hearing studies, zebrafish models for kidney development

    • Reconstituted systems: Liposome-based assays to study membrane interactions and fusion activity

    • Protein expression systems: E. coli-based expression of recombinant CLIC5 with N-terminal His tag for structural and biochemical studies

  • What are the best methods for producing and purifying recombinant CLIC5?

    The standard protocol for producing recombinant CLIC5 includes:

    • Expression system: E. coli (preferred for high yield)

    • Vector choice: pQE30 or similar vectors with His-tag for purification

    • Purification strategy:

      1. Cell lysis in appropriate buffer (often containing guanidine-HCl for denaturation)

      2. Nickel affinity chromatography for His-tagged proteins

      3. Additional purification by ion-exchange or size-exclusion chromatography

      4. Storage as lyophilized powder with stabilizers (e.g., 6% trehalose)

    • Quality control: SDS-PAGE to assess purity (>90% purity typical)

    • Storage recommendations: Long-term at -20°C/-80°C with 5-50% glycerol; avoid repeated freeze-thaw cycles

Advanced Research Questions

  • How does CLIC5 regulate muscle development and regeneration?

    CLIC5 plays a critical role in balancing myoblast proliferation and differentiation:

    • CLIC5 knockout in mice (CLIC5^MKO) results in reduced body weight (9.67% reduction in males) and decreased muscle mass in tibialis anterior and gastrocnemius muscles

    • CLIC5 regulates satellite cell populations, with knockout causing a 26.55% reduction in muscle satellite cells

    • CLIC5 inhibits myoblast proliferation while promoting myogenic differentiation

    • Mechanistically, CLIC5 mediates these effects through the canonical Wnt/β-catenin signaling pathway

    • CLIC5 interacts with biglycan (BGN), which enhances Wnt signaling activity

    • Gene expression analysis shows CLIC5 regulates myogenic factors (Myf5, MyoD, MyoG) and cell cycle genes (p21, CCND1, CDK2)

  • What experimental approaches can reveal CLIC5's membrane fusion capabilities?

    Recent research has identified CLIC5 as a fusogen, with several techniques to measure this activity:

    • Liposome co-floatation assays: Demonstrates direct binding of CLIC5 to lipid vesicles

    • Dynamic light scattering (DLS): Shows increased liposome diameter following CLIC5 incubation, indicating fusion or aggregation

    • FRET measurements: Using tryptophan residues in CLIC5 as energy donors and dansyl-PE in liposomes as acceptors to detect protein-membrane interactions

    • R18-based lipid mixing assay: The concentration-dependent dequenching of this self-quenching dye demonstrates membrane fusion

    • Content mixing assays: Confirms complete fusion rather than just hemifusion or aggregation

    • pH dependence studies: Shows enhanced fusion activity at acidic pH, consistent with CLIC5's conformational change trigger

  • How do mutations in CLIC5 affect hearing function?

    CLIC5 is critical for normal hearing function, as evidenced by studies on jitterbug (jbg) mutant mice:

    • The jbg mutation is a 97 bp intragenic deletion causing exon 5 skipping, creating a premature stop codon

    • CLIC5 is highly expressed in stereocilia of hair cells, specifically at their basal region

    • Mutant mice exhibit impaired hearing, vestibular dysfunction, and progressive loss of stereocilia

    • Histological analysis reveals dysmorphic stereocilia and progressive hair cell degeneration

    • CLIC5 loss affects radixin expression, suggesting a functional relationship

    • CLIC5 is expressed at high levels in stereocilia in approximately 1:1 molar ratio with radixin

    • CLIC5 likely helps form or stabilize connections between the plasma membrane and filamentous actin core in stereocilia

  • What is the relationship between CLIC5 and cytoskeletal proteins?

    CLIC5 interacts with multiple cytoskeletal components:

    • In placental microvilli, CLIC5 forms a multimeric complex with actin, ezrin, α-actinin, gelsolin, and IQGAP1

    • CLIC5 is associated with the detergent-insoluble cytoskeletal fraction of microvilli

    • In hair cells, CLIC5 co-localizes with radixin at the base of stereocilia

    • In muscle tissue, CLIC5 interacts with biglycan (BGN), confirmed by immunoprecipitation analysis

    • CLIC5 binding to BGN occurs via residues 1-105, a domain crucial for membrane insertion

    • CLIC5 knockout reduces BGN protein levels in both cytosol (34% decrease) and plasma membrane (65% decrease)

    • In zebrafish kidney, CLIC5 regulates phosphorylation of Ezrin/Radixin/Moesin (ERM) proteins

  • How can researchers differentiate between CLIC5 isoforms in experimental studies?

    Distinguishing between CLIC5 isoforms requires specific methodological approaches:

    • Northern blotting: Using probes specific to exon 1A (for CLIC5A) or the 3'-UTR (for both isoforms)

    • RT-PCR: Designing primers that span isoform-specific exons

    • Antibody generation: Creating antibodies against isoform-specific regions

    • Expression constructs: Cloning specific isoforms into expression vectors for functional studies

    • Isoform-specific knockdown: Designing siRNAs targeting unique regions

    • Tissue selection: Focusing on tissues with predominant expression of one isoform (e.g., glomeruli for CLIC5A, pronephric tubules for CLIC5B)

    • Conditional knockout models: Creating isoform-specific deletion models using appropriate Cre drivers

  • What approaches are most effective for studying CLIC5's role in ciliogenesis?

    CLIC5B has been implicated in cilia formation and function:

    • Zebrafish models: Knockdown of CLIC5B results in ciliopathy-associated phenotypes (ventral body curvature, otolith deposition defects, altered left-right asymmetry, hydrocephalus, pronephric cysts)

    • Immunostaining: Localizes CLIC5B to cilia

    • In situ hybridization: Reveals expression patterns in ciliated tissues

    • Wnt signaling analysis: Assesses dysregulation of cilia-dependent Wnt pathway components

    • Electron microscopy: Evaluates structural defects in cilia

    • Functional assays: Measures ciliary motility or sensory functions

    • Rescue experiments: Tests if wild-type CLIC5B can restore normal phenotypes in knockdown models

  • How does the membrane-binding capability of CLIC5 relate to its function?

    CLIC5's ability to transition between soluble and membrane-bound forms is central to its function:

    • CLIC5 undergoes conformational changes when interacting with membranes, exposing its hydrophobic inter-domain interface

    • This transition is facilitated by acidic pH and oxidative conditions

    • Membrane binding enables CLIC5's fusogenic activity, allowing it to induce fusion between membranes

    • The N-terminal domain (residues 1-105) is critical for membrane insertion and protein partner binding

    • X-ray crystallography and mass spectrometry analyses indicate that CLIC5's inherent flexibility is a prerequisite for these conformational transitions

    • Mutations affecting the inter-domain interface disrupt both in vitro fusion activity and in vivo function in model organisms

  • What considerations are important when designing CLIC5 knockout or conditional knockout models?

    Creating effective CLIC5 genetic models requires careful planning:

    • Targeting strategy: For conditional knockouts, introducing loxP sites flanking critical exons (e.g., exon 2 in mouse models)

    • Choice of Cre driver: Selecting appropriate tissue-specific promoters (e.g., Myf5-Cre for muscle studies)

    • Validation methods: Confirming knockout through qPCR, Western blotting, and immunohistochemistry

    • Compensation assessment: Evaluating expression changes in other CLIC family members (CLIC1-4)

    • Phenotypic analysis: Thorough examination of affected tissues and physiological functions

    • Alternative approaches: AAV-mediated gene delivery for tissue-specific studies or acute deletion

    • Controls: Using properly genotyped littermates (CLIC5-Flox;Cre-negative) as wild-type controls

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.