Recombinant Bovine Claudin-10 (CLDN10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CLDN10; Claudin-10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
CLDN10
Target Protein Sequence
MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKTCVTDSTGV SNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALIGMKCTKVGGSDKAKAKIACLA GIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCLIGGVIFC FSISDNNKAPRMGYTYNGATSVMSSRTKYHGREGDLKTPNPSKQFDKNAYV
Uniprot No.

Target Background

Function
Claudin-10 plays a crucial role in tight junction-specific obliteration of the intercellular space through calcium-independent cell-adhesion activity. It is involved in regulating paracellular epithelia permeability to ions in multiple organs. Claudin-10 acts as a paracellular ion channel, likely forming permselective pores. Isoform 1 appears to create pores preferentially permeable to cations, while isoform 2 is more permeable to anions. In sweat glands and the thick ascending limb (TAL) of Henle's loop in the kidney, Claudin-10 controls paracellular sodium permeability, which is essential for proper sweat production and renal function.
Database Links
Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is Claudin-10 and what is its primary function?

Claudin-10 (CLDN10) is a membrane integral protein that functions as a key component of tight junctions. It belongs to the claudin family of proteins that regulate paracellular permeability and maintain cell polarity. In various tissues, CLDN10 forms tight junction strands that control the passage of ions and small molecules through the paracellular space between adjacent cells .

The specific role of CLDN10 varies depending on tissue localization. For example, in renal tissues, CLDN10 is strongly expressed in the thick ascending limb (TAL) of Henle's loop and weakly observed in the proximal tubule, where it contributes to ion selectivity and reabsorption processes . In the brain, CLDN10 contributes to the blood-brain barrier function in cerebral endothelial cells .

What are the primary isoforms of bovine CLDN10 and how do they differ?

Bovine CLDN10, like its human counterpart, has two main isoforms: CLDN10A and CLDN10B, which arise from alternative splicing of the CLDN10 gene. These isoforms differ primarily in their first exon, which affects their N-terminal regions and first transmembrane domains.

The differences between these isoforms affect their ion selectivity and tissue distribution:

  • CLDN10A: Preferentially expressed in the proximal tubule segments of the kidney and shows preference for anion permeability.

  • CLDN10B: Predominantly found in the thick ascending limb of the nephron and demonstrates cation-selective properties.

Both isoforms share identical C-terminal regions (as evidenced by the development of antibodies that recognize the C-terminal amino acid region 210-224 that is identical in both CLDN10A and CLDN10B) .

What expression patterns of CLDN10 have been observed in bovine tissues?

CLDN10 shows tissue-specific expression patterns that are conserved across mammalian species. In bovine tissues, CLDN10 expression patterns largely mirror those observed in human and murine models:

  • Kidney: Strong expression in the thick ascending limb (TAL) of Henle's loop and weaker expression in the proximal tubule

  • Brain: Expression in cerebral endothelial cells contributing to blood-brain barrier function

  • Epithelial tissues: Variable expression depending on the specific tissue type

When working with bovine CLDN10, immunohistochemical analysis using specific antibodies can help determine precise localization patterns. As demonstrated in human tissues, semi-quantitative scoring systems like the immunoreactive score (IRS) can be used to evaluate expression levels based on signal intensity and percentage of positive cells .

What are the recommended approaches for generating recombinant bovine CLDN10?

For generating recombinant bovine CLDN10, consider the following methodological approach:

  • Gene Cloning: Amplify the coding sequence of bovine CLDN10 (either CLDN10A or CLDN10B) using PCR with primers designed from the bovine genome database.

  • Expression Vector Selection: Select an appropriate expression vector based on your experimental needs:

    • pET system vectors for bacterial expression (though membrane proteins may require refolding)

    • Mammalian expression vectors (e.g., pcDNA3.1, pCMV) for cell culture studies

    • Baculovirus expression systems for insect cell expression, which often works well for membrane proteins

  • Cell Culture Systems:

    • For functional studies, transfection into mammalian cell lines like hCMEC/D3 (human cerebral microvascular endothelial cell line) has been successful with human CLDN10

    • Culture conditions typically include 37°C, 5% CO₂, and 95% humidity

  • Purification Strategies:

    • Add appropriate affinity tags (His-tag, FLAG, etc.) to facilitate purification

    • Use detergent solubilization methods optimized for membrane proteins

    • Consider nanodiscs or liposome reconstitution for maintaining native conformation

What methods are most effective for detecting and quantifying CLDN10 expression?

Multiple complementary approaches should be employed for reliable detection and quantification of CLDN10:

  • Western Blotting:

    • Use specific monoclonal antibodies to avoid cross-reactivity with other claudin family members

    • Consider that commercial polyclonal antibodies may cross-react with related claudins (particularly CLDN2/8/15)

    • Include proper positive and negative controls to validate specificity

  • Immunohistochemistry (IHC):

    • For formalin-fixed paraffin-embedded (FFPE) tissues, careful antigen retrieval is essential

    • Validate antibody specificity using transfected cells as positive controls

    • Employ semi-quantitative scoring systems like IRS for expression analysis

  • Immunofluorescence:

    • For fresh tissue samples, embedding in OCT compound and thin-slicing at -20°C is recommended

    • Cell cultures grown on glass-based dishes coated with appropriate matrices work well

    • Standard protocol includes fixation in 4% paraformaldehyde with 0.1% Triton-X for 10 minutes at room temperature

    • Use confocal microscopy for accurate localization assessment

  • qRT-PCR:

    • Design isoform-specific primers to distinguish between CLDN10A and CLDN10B

    • Normalize expression to appropriate housekeeping genes

    • Consider that transcript levels may not always correlate with protein levels

How can researchers ensure antibody specificity for CLDN10 studies?

Ensuring antibody specificity is critical for CLDN10 research due to potential cross-reactivity with other claudin family members. A comprehensive validation approach includes:

  • Test against multiple claudin subtypes: Particularly evaluate cross-reactivity with CLDN2, CLDN5, CLDN8, and CLDN15, which are closely related to CLDN10 .

  • Use multiple detection methods: Confirm specificity through Western blotting, immunohistochemistry, and immunofluorescence techniques.

  • Include proper controls:

    • Positive controls: Cells transfected with CLDN10 expression vectors

    • Negative controls: Non-transfected cells or cells expressing other claudin family members

    • Tissue controls: Use tissues with known CLDN10 expression patterns (e.g., kidney TAL segments)

  • Generate monoclonal antibodies: Consider developing specific monoclonal antibodies as demonstrated in the research by Yukinori Yamaguchi et al., who created a monoclonal antibody against the C-terminal amino acid region 210-224 that is identical in both CLDN10A and CLDN10B isoforms .

  • Validation through multiple applications: Test antibodies in different experimental conditions and applications to ensure consistent specificity.

How does CLDN10 participate in cellular signaling pathways?

CLDN10 is not merely a structural component of tight junctions but also participates in cellular signaling pathways through protein-protein interactions:

  • CLDN10-LAT1 Signaling:

    • CLDN10 forms a complex with the amino acid transporter LAT1 on the cell membrane

    • This interaction activates mTOR signaling and influences the expression of downstream targets

    • CLDN10-LAT1 signaling promotes cell viability, proliferation, and migration in some cancer cell types

  • Structural Interactions:

    • The interaction between CLDN10 and LAT1 likely involves CLDN10's first transmembrane domain (TM1) and LAT1's fourth transmembrane domain (TM4)

    • These interactions occur outside of typical tight junction structures, suggesting extrajunctional roles for CLDN10

  • Downstream Signaling Effects:

    • CLDN10-mediated signaling activates glycolysis-associated and MYC-target genes

    • These pathways contribute to cell growth, metabolism, and proliferation

Understanding these signaling functions is essential for interpreting experimental results and designing interventions targeting CLDN10-mediated pathways.

What phenotypic changes occur in CLDN10 knockout models?

CLDN10 knockout models provide valuable insights into the protein's physiological functions:

  • Isoform-Specific Effects:

    • CLDN10a knockout mice were found to be fertile and without overt phenotypes

    • Interestingly, upon CLDN10a deletion, CLDN2 expression increased in proximal tubule segments, suggesting compensatory mechanisms

  • Generation of Knockout Models:

    • For CLDN10a knockout, a targeting vector can be constructed with loxP sites flanking exon 1a

    • Homologous recombination in embryonic stem cells, followed by Cre recombinase-mediated deletion, has been successfully employed

    • Careful backcrossing (>10 generations) to establish a pure genetic background is recommended

  • Functional Compensation:

    • The replacement of CLDN10a by CLDN2 in proximal tubule segments illustrates the redundancy and compensation mechanisms within the claudin family

    • This compensation may mask certain phenotypes and should be considered when interpreting knockout results

How can recombinant CLDN10 be utilized to study blood-brain barrier function?

Recombinant CLDN10 provides valuable tools for investigating blood-brain barrier (BBB) function:

  • In Vitro BBB Models:

    • Transfect cerebral endothelial cell lines (e.g., hCMEC/D3) with recombinant bovine CLDN10

    • Culture conditions should be maintained at 37°C, 5% CO₂, and 95% humidity

    • For certain specialized endothelial cell lines (e.g., TY9, TY10), culture at 34°C may be required

  • Barrier Integrity Assessment:

    • Measure transendothelial electrical resistance (TEER) to assess barrier tightness

    • Perform permeability assays using labeled tracers of different molecular weights

    • Compare CLDN10-expressing and control cells to determine CLDN10's specific contribution to barrier properties

  • Drug Delivery Studies:

    • Use CLDN10-manipulated cell models to evaluate transendothelial drug delivery

    • siRNA approaches can be employed to knock down CLDN10 expression (follow manufacturer's protocols for transfection)

    • Compare drug permeability across control and CLDN10-manipulated barriers

What role does CLDN10 play in cancer biology and how can this be studied?

CLDN10's role in cancer biology, particularly in renal cell carcinoma, presents an important research area:

  • Expression Analysis in Cancer Tissues:

    • Examine CLDN10 expression levels using immunohistochemistry with specific antibodies

    • Utilize a semi-quantitative scoring system based on signal intensity (SI: 0-3) and percentage of positive cells (PP: 0-4)

    • Calculate the immunoreactive score (IRS) by multiplying SI and PP values

    • Determine appropriate cut-off values using receiver operating characteristic (ROC) curve analysis

  • Functional Studies in Cancer Cell Lines:

    • Generate stable cancer cell lines expressing CLDN10 (especially CLDN10A)

    • Compare phenotypes with control cells in terms of:

      • Cell viability and proliferation

      • Migration and invasion capacity

      • Tumor growth in xenograft models

    • Established cell lines like 786-O, ACHN, and OS-RC-2 have been successfully used in CLDN10 research

  • Signaling Pathway Analysis:

    • Investigate CLDN10-LAT1 interactions using co-immunoprecipitation

    • Examine downstream effects on mTOR signaling and MYC target gene expression

    • Use gene set enrichment analysis (GSEA) to identify affected pathways

What techniques are most effective for studying CLDN10 protein-protein interactions?

Understanding CLDN10's protein-protein interactions is crucial for elucidating its functions beyond tight junction formation:

  • Immunoprecipitation-Mass Spectrometry (IP-MS):

    • This approach has successfully identified the CLDN10-LAT1 interaction

    • Use cells expressing tagged CLDN10 (e.g., FLAG-tag) for pull-down experiments

    • Analyze the precipitated protein complexes using mass spectrometry to identify interacting partners

  • Co-immunoprecipitation (Co-IP):

    • Confirm specific interactions identified by IP-MS

    • Use antibodies against either CLDN10 or its suspected binding partners

    • Western blot analysis of the precipitated complexes can verify the interactions

  • Proximity Ligation Assays (PLA):

    • Detect protein-protein interactions in situ with high sensitivity

    • This technique can confirm interactions in their native cellular context

    • Particularly useful for membrane proteins like CLDN10

  • Structural Prediction and Analysis:

    • Computational approaches can predict interaction domains

    • For example, analysis has suggested that CLDN10-TM1 interacts with LAT1-TM4

    • These predictions can guide the design of mutants to disrupt specific interactions

What are common challenges in working with recombinant bovine CLDN10 and how can they be addressed?

Working with recombinant membrane proteins like CLDN10 presents several challenges:

  • Expression and Solubility Issues:

    • Challenge: Low expression yields or protein aggregation

    • Solution: Optimize expression conditions (temperature, induction time), use specialized host strains, and consider fusion tags that enhance solubility

    • For membrane proteins, detergent screening is crucial for effective solubilization

  • Antibody Cross-Reactivity:

    • Challenge: Commercial antibodies may cross-react with other claudin family members

    • Solution: Validate antibody specificity using multiple techniques and controls

    • Consider developing specific monoclonal antibodies for CLDN10 research

  • Functional Assessment:

    • Challenge: Distinguishing CLDN10-specific effects from compensatory responses

    • Solution: Use multiple complementary approaches, including gain-of-function and loss-of-function studies

    • Account for potential compensation by other claudins (e.g., CLDN2 replacing CLDN10a in knockout models)

How can researchers differentiate between contradictory findings in CLDN10 research?

CLDN10 research has produced some contradictory findings, particularly regarding its role in cancer:

What emerging technologies might advance CLDN10 research?

Several emerging technologies offer promising avenues for advancing CLDN10 research:

  • CRISPR-Cas9 Genome Editing:

    • Precise manipulation of endogenous CLDN10 genes

    • Creation of isoform-specific knockouts or knockins

    • Introduction of specific mutations to study structure-function relationships

  • Cryo-Electron Microscopy:

    • Determination of high-resolution structures of CLDN10 alone or in complex with interacting partners

    • Insights into the structural basis of CLDN10-LAT1 interactions

  • Single-Cell Analysis:

    • Examination of cell-to-cell variability in CLDN10 expression and function

    • Correlation of CLDN10 expression with cell-specific phenotypes

  • Advanced Imaging Techniques:

    • Super-resolution microscopy for detailed visualization of CLDN10 localization

    • Live-cell imaging to track CLDN10 dynamics in real-time

What therapeutic potential does CLDN10-targeted intervention hold?

CLDN10-targeted interventions show therapeutic potential in several areas:

  • Cancer Therapy:

    • High CLDN10 expression predicts poor prognosis in clear cell renal cell carcinoma (ccRCC)

    • CLDN10-LAT1 signaling promotes malignant phenotypes in ccRCC cells

    • Disrupting this interaction could represent a novel therapeutic approach

  • Blood-Brain Barrier Modulation:

    • CLDN10 contributes to blood-brain barrier function

    • Targeted modulation could potentially enhance drug delivery to the brain

  • Kidney Disorders:

    • Given CLDN10's role in renal ion transport, targeting it might help address specific electrolyte disorders

    • Understanding the compensatory mechanisms (e.g., CLDN2 upregulation when CLDN10a is deleted) is crucial for predicting therapeutic outcomes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.