Recombinant Bovine Claudin-12 (CLDN12)

Shipped with Ice Packs
In Stock

Description

Introduction to Claudin-12 and the Claudin Superfamily

Claudin-12 belongs to the claudin superfamily, a group of structurally related proteins that serve as essential components of tight junctions. These tight junctions are critical intercellular structures that control paracellular permeability and maintain cell polarity. The claudin family comprises multiple members that show tissue-specific expression patterns and unique functional characteristics in regulating the passage of ions and small molecules between cells. Within this diverse family, Claudin-12 has emerged as a protein of particular interest due to its widespread expression and specialized functions.

Claudin-12 is a 244-amino acid multi-pass membrane protein found in numerous tissues, including the brain, duodenum, jejunum, ileum, and colon . Its primary localization at cell junctions underscores its importance in maintaining tissue integrity and regulating selective permeability across epithelial and endothelial barriers. Unlike some other claudin family members, Claudin-12 demonstrates some unique functional characteristics, particularly in relation to calcium transport and hyperammonemia regulation.

The claudin superfamily members share a common structural architecture, typically featuring four transmembrane domains, two extracellular loops, and cytoplasmic N- and C-terminal domains. This structural organization enables claudins to form complex arrangements within tight junctions, creating selective barriers that regulate the passage of ions and small molecules between adjacent cells. The first extracellular loop contains charged amino acids that determine the charge selectivity of the paracellular pathway, while the second extracellular loop mediates claudin-claudin interactions between adjacent cells.

Structure-Function Relationships in Claudin-12

The structural features of Claudin-12 are intimately tied to its functions in tight junctions. Based on homology with other claudin family members, Bovine Claudin-12 is expected to contain:

  1. Four transmembrane domains that anchor the protein in the cell membrane

  2. Two extracellular loops that participate in claudin-claudin interactions between adjacent cells

  3. Cytoplasmic N- and C-terminal domains that interact with scaffolding proteins and signaling molecules

These structural elements enable Claudin-12 to participate in tight junction formation and to create selective paracellular channels. The specific amino acid composition of the extracellular loops determines the ion selectivity of these channels, with Claudin-12 being particularly associated with calcium permeability.

Production and Purification of Recombinant Bovine Claudin-12

The production of recombinant Bovine Claudin-12 typically employs bacterial expression systems, with E. coli being the most common host organism due to its rapid growth, high protein yields, and well-established genetic manipulation techniques . The process begins with isolating the bovine CLDN12 gene and inserting it into an expression vector containing appropriate regulatory elements and the sequence for an N-terminal His-tag.

After transformation into E. coli, the bacteria are cultured under conditions optimized for protein expression. Following induction of protein synthesis, the bacterial cells are harvested and lysed to release the recombinant protein. The His-tagged Bovine Claudin-12 is then purified using affinity chromatography, where the protein binds to nickel or cobalt-charged resin via the His-tag.

The purified protein is typically supplied as a lyophilized powder for stability during shipping and storage . For experimental use, the protein must be reconstituted in an appropriate buffer, with manufacturers recommending deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL. Addition of 5-50% glycerol as a cryoprotectant is recommended for long-term storage at -20°C or -80°C .

Quality Control and Purity Assessment

Commercial recombinant Bovine Claudin-12 preparations typically undergo rigorous quality control measures to ensure high purity and biological activity. These assessments commonly include:

  1. SDS-PAGE analysis to confirm protein size and purity (typically >90%)

  2. Western blotting to verify protein identity

  3. Mass spectrometry for precise molecular weight determination

  4. Functional assays to confirm biological activity

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of functionality . Working aliquots can be stored at 4°C for up to one week, while longer-term storage requires -20°C or -80°C conditions.

Biological Functions of Claudin-12

Claudin-12 plays several important biological roles that are likely conserved in the bovine form of the protein. Understanding these functions provides context for research applications of recombinant Bovine Claudin-12.

Tight Junction Formation and Barrier Function

The primary function of Claudin-12 is its role in tight junction formation and maintenance. Claudin-12 contributes to the "tight junction-specific obliteration of the intercellular space" through calcium-independent cell-adhesion activity . This barrier function is essential for maintaining tissue integrity and controlling paracellular permeability in various epithelia and endothelia.

Calcium Homeostasis Regulation

A particularly important function of Claudin-12 is its role in calcium homeostasis. Research suggests that Claudin-12 forms paracellular calcium channels in intestinal epithelia . Interestingly, Claudin-12 expression is upregulated in enterocytes through vitamin D receptors, suggesting a critical role in vitamin D-dependent calcium homeostasis . This function has significant implications for understanding calcium absorption and metabolism in mammals, including bovines.

Regulation of Hyperammonemia

Claudin-12 may also be involved in tight junction integrity by regulating hyperammonemia . Ammonia can alter brain capillary endothelial cell gene expression and transporter function, with Claudin-12 potentially playing a protective role. This function could be particularly relevant in understanding neurological conditions associated with elevated ammonia levels.

Potential Role in Cancer Progression

Recent research has identified altered expression of Claudin-12 in certain cancers. For example, increased expression of Claudin-12 has been associated with metastatic potential in lung squamous cell carcinoma (SqCC) . Claudin-12 appears to promote epithelial-mesenchymal transition (EMT) through the Tyrosine kinase 2 (Tyk2)/Signal transducer and activator of transcription 1 (Stat1) signaling pathway . While this research pertains to human Claudin-12, it raises interesting questions about conserved functions in bovine Claudin-12 and potential comparative studies.

Comparative Analysis: Bovine versus Human Claudin-12

Understanding the similarities and differences between bovine and human Claudin-12 is valuable for interpreting research findings and determining the applicability of bovine models to human physiology and pathology.

Bovine Claudin-12 (UniProt ID: Q0IIL2) and human Claudin-12 share significant sequence homology, reflecting evolutionary conservation of this important tight junction protein. Both proteins consist of 244 amino acids and exhibit similar structural features, including four transmembrane domains, two extracellular loops, and cytoplasmic termini .

The high degree of conservation suggests functional similarities between bovine and human Claudin-12, particularly in fundamental roles such as tight junction formation and calcium transport regulation. This conservation makes recombinant Bovine Claudin-12 a potentially valuable tool for comparative studies and preliminary investigations that may have implications for human health.

Research Applications of Recombinant Bovine Claudin-12

Recombinant Bovine Claudin-12 serves as a valuable research tool in multiple scientific contexts. Its availability in purified form enables investigations that would be difficult or impossible with native protein isolated from tissues.

Functional Assays and Cell Biology

Recombinant Bovine Claudin-12 can be used in functional assays to investigate its role in tight junction formation, paracellular permeability, and calcium transport. These studies might involve:

  1. Cell culture models to examine the effects of exogenous Claudin-12 on tight junction assembly and barrier function

  2. Permeability assays to assess ion selectivity and transport properties

  3. Binding studies to identify interaction partners within tight junction complexes

Antibody Production and Validation

Another important application of recombinant Bovine Claudin-12 is in the production and validation of antibodies against this protein. High-quality antibodies are essential tools for techniques such as immunohistochemistry, Western blotting, and immunoprecipitation. Purified recombinant protein serves as both an immunogen for antibody production and a standard for antibody validation.

Veterinary Research and Bovine Health

In the context of veterinary science, recombinant Bovine Claudin-12 enables research into bovine-specific aspects of epithelial and endothelial barrier function. This research has implications for understanding and addressing health issues in cattle, including intestinal disorders, metabolic conditions, and infections that affect barrier integrity.

Technical Considerations for Working with Recombinant Bovine Claudin-12

Researchers working with recombinant Bovine Claudin-12 should consider several technical aspects to ensure optimal experimental outcomes.

Experimental Considerations

When designing experiments with recombinant Bovine Claudin-12, researchers should consider:

  1. The presence of the His-tag and its potential impact on protein function or interactions

  2. Appropriate controls, including tag-only controls when applicable

  3. Protein concentration and exposure time, as these may influence experimental outcomes

  4. Compatibility with buffers and other reagents used in experimental protocols

Functional Validation

Before proceeding with complex experiments, it is advisable to validate the functionality of the recombinant protein. This might involve simple binding assays or cell-based tests to confirm that the recombinant Bovine Claudin-12 exhibits expected activities and interactions.

Future Research Directions

Research on Claudin-12 in general, and Bovine Claudin-12 specifically, continues to evolve, with several promising directions for future investigation.

Comparative Studies Across Species

Comparative analyses of Claudin-12 across different species could illuminate evolutionary conservation and divergence in tight junction biology. Such studies might identify species-specific adaptations in barrier function and ion transport, with potential implications for understanding physiological differences between species.

Disease Associations and Therapeutic Applications

The potential involvement of Claudin-12 in various pathological conditions, including cancer and disorders of calcium metabolism, suggests avenues for translational research. Investigations into how alterations in Claudin-12 expression or function contribute to disease states might reveal new therapeutic targets or diagnostic markers.

Agricultural and Veterinary Applications

In the context of bovine health and agricultural productivity, research on Bovine Claudin-12 could lead to improved understanding of intestinal function, nutrient absorption, and barrier integrity in cattle. Such knowledge might inform strategies for enhancing animal health and productivity in agricultural settings.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CLDN12; Claudin-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
CLDN12
Target Protein Sequence
MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCAR YDGGNDCLMYDAAWYSSVDQLDLRVLQFALPLSILIAMGALLLCLIGMCNTAFRSSVPNI KLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNRKFEPVFAFDYAVYVTVA SAGGLFMTALLLFIWYCACKSLPSPFWQPLYSHPPGMHTYSQPYSARSRLSAIEIDIPVV SHTT
Uniprot No.

Target Background

Function

Recombinant Bovine Claudin-12 (CLDN12) plays a crucial role in tight junction-specific obliteration of the intercellular space through calcium-independent cell-adhesion activity.

Database Links

KEGG: bta:538709

STRING: 9913.ENSBTAP00000025950

UniGene: Bt.1196

Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is Claudin-12 and what is its biological significance?

Claudin-12 (CLDN12) is a critical component of tight junctions that determines epithelial and endothelial barrier properties, cell polarity, and regulates paracellular permeability . Unlike some other claudin family members, CLDN12 has been identified as particularly important for calcium (Ca²⁺) permeability across epithelia . Studies in mouse models demonstrate that CLDN12 works independently but complementarily with Claudin-2 to maintain calcium homeostasis, with both proteins contributing to paracellular calcium permeability in the proximal colon and other tissues . CLDN12 is expressed in various cell types, including differentiating chondrocytes in articular cartilage and growth plates, suggesting important roles in skeletal development and maintenance .

What experimental systems are appropriate for studying recombinant bovine CLDN12?

Recombinant bovine CLDN12 can be studied in several experimental systems:

Experimental SystemApplicationsConsiderations
Cell culture modelsTransfection studies, localization, functional assaysSelect cell lines lacking endogenous CLDN12 expression for cleaner interpretation
Transwell migration assaysCell migration studies, barrier function assessmentAppropriate for studying tight junction integrity and paracellular transport
In vitro binding assaysProtein-protein interactions, ligand bindingRequires properly folded recombinant protein, may require reconstitution in lipid environments
Calcium flux assaysPermeability studiesMust control for other calcium channels/transporters
ImmunohistochemistryLocalization in tissues, co-localization studiesRequires validated antibodies with confirmed specificity

When designing experiments with recombinant bovine CLDN12, researchers should consider including appropriate controls and validation steps to ensure the recombinant protein behaves similarly to the native protein .

What are the optimal expression systems for producing functional recombinant bovine CLDN12?

While E. coli is commonly used for claudin expression (as seen with mouse CLDN12) , membrane proteins like claudins often benefit from expression in eukaryotic systems. For bovine CLDN12:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliCost-effective, high yield, simple purificationLacks post-translational modifications, potential protein misfoldingStructural studies, antibody production, peptide competition assays
Insect cellsBetter protein folding, some post-translational modificationsMore complex than bacterial systemsFunctional studies, structural biology
Mammalian cellsNative-like modifications and foldingLower yields, higher costCell-based functional assays, studies requiring authentic modifications

For optimal results with E. coli expression, researchers should consider using specialized strains designed for membrane protein expression, fusion tags that enhance solubility, and optimized refolding protocols if the protein forms inclusion bodies .

What purification strategies yield the highest purity and functionality for recombinant bovine CLDN12?

Purification of recombinant bovine CLDN12 requires specialized approaches due to its membrane protein nature:

  • For His-tagged CLDN12, immobilized metal affinity chromatography (IMAC) provides the initial purification step .

  • Size exclusion chromatography helps separate properly folded protein from aggregates.

  • For functional studies, reconstitution into lipid nanodiscs or liposomes may be necessary to maintain native conformation.

  • Quality control should include SDS-PAGE, Western blotting, and functional assays such as liposome permeability tests to verify calcium transport functionality.

Researchers working with claudins should be aware that maintaining the native conformation during purification is challenging but critical for functional studies. Detergent selection is particularly important, with mild non-ionic detergents often yielding better results for preserving protein structure .

How can researchers assess the calcium permeability function of recombinant bovine CLDN12?

Based on studies with human and mouse CLDN12, several approaches are available for assessing calcium permeability:

  • Transwell permeability assays: Epithelial or endothelial cells transfected with bovine CLDN12 are grown on permeable supports, and calcium flux is measured across the monolayer. This approach allows for direct quantification of paracellular calcium transport .

  • Liposome reconstitution: Purified recombinant CLDN12 can be reconstituted into liposomes, and calcium flux measured using fluorescent calcium indicators or radioactive calcium tracers.

  • Ussing chamber experiments: Similar to studies performed with mouse tissue, this technique allows measurement of calcium permeability across intact epithelia . For recombinant protein studies, cell monolayers expressing the protein would be used.

When interpreting results, researchers should consider that CLDN12's function may depend on interactions with other tight junction proteins and that isolated recombinant protein may not fully recapitulate native function .

What methods are effective for studying CLDN12's role in cell migration and metastasis?

Based on findings that claudin-12 is involved in cell migration and potential metastasis regulation , researchers can employ several methods:

MethodDescriptionKey Parameters to Measure
Transwell migration assaysCells expressing bovine CLDN12 migrate through a membrane toward a chemoattractantNumber of migrated cells, migration rate
Wound healing assaysCell monolayers are scratched and wound closure is monitoredClosure rate, migration directionality
Impedance-based real-time cell analysisContinuous monitoring of cell attachment, spreading, and migrationCell index changes over time
3D invasion assaysCells invade through extracellular matrixInvasion depth, morphology changes

Additionally, antibody blockade experiments using anti-CLDN12 antibodies or competitive inhibitory peptides derived from CLDN12 extracellular domains can help determine if interfering with CLDN12 function affects migration, as demonstrated in previous studies .

How can researchers develop effective anti-CLDN12 antibodies and peptides for therapeutic targeting?

Research indicates that anti-claudin-12 antibodies and competitive inhibitory peptides can block cell migration and potentially inhibit metastasis in tissues expressing claudin-12 . For developing these reagents:

  • Antibody development strategy:

    • Immunize with recombinant bovine CLDN12 extracellular domains

    • Screen for antibodies that specifically recognize native conformation

    • Validate antibody binding to intact cells expressing CLDN12

    • Test functional effects in migration and calcium flux assays

  • Inhibitory peptide design:

    • Target the extracellular loops of CLDN12

    • Previous studies showed peptides representing extracellular domains (particularly peptides designated p5 and p6) effectively blocked migration

    • Consider peptidomimetic approaches to improve stability and pharmacokinetics

    • Test specificity against other claudin family members

Both approaches require careful validation to ensure specificity for CLDN12 and effectiveness across different cell types expressing the protein .

What techniques can resolve contradictory findings regarding CLDN12's role in calcium homeostasis versus bone development?

Studies show seemingly contrasting roles for CLDN12 - it contributes to calcium permeability but knockout mice show increased articular cartilage rather than expected calcium-related phenotypes . To resolve these contradictions:

  • Tissue-specific conditional knockout models: Generate bovine cell lines or model systems with tissue-specific CLDN12 deletion to distinguish direct versus compensatory effects.

  • Combined knockout approaches: As seen with Claudin-2/Claudin-12 double knockout mice, which revealed more severe phenotypes than single knockouts , researchers should consider redundancy mechanisms.

  • Time-course studies: Examine developmental stages to identify when CLDN12 expression patterns change from broad (chondrocytes and osteoblasts) to restricted (primarily chondrocytes) .

  • Comprehensive calcium flux measurements: Measure both transcellular and paracellular calcium transport to determine if compensatory mechanisms activate when CLDN12 is absent.

  • Gene expression profiling: Identify changes in expression of other calcium transporters or tight junction proteins that might compensate for CLDN12 loss.

The apparent contradiction likely reflects tissue-specific roles and compensatory mechanisms rather than true contradictions in CLDN12 function .

Which domains of bovine CLDN12 are critical for calcium permeability and how can they be studied?

Based on claudin structure-function studies, the extracellular domains are likely critical for forming paracellular calcium pores . To study these domains:

  • Domain mapping experiments:

    • Generate recombinant proteins with specific mutations in extracellular loops

    • Develop chimeric proteins where domains are swapped with non-calcium permeable claudins

    • Perform alanine scanning mutagenesis of charged residues

  • Structural biology approaches:

    • Cryo-electron microscopy of reconstituted CLDN12 in nanodiscs

    • X-ray crystallography of stabilized CLDN12 constructs

    • Molecular dynamics simulations to identify potential calcium binding sites

  • Functional validation:

    • Express mutant constructs in epithelial cells lacking endogenous CLDN12

    • Measure calcium permeability using Ussing chamber experiments or calcium flux assays

    • Validate protein localization to ensure proper trafficking to tight junctions

Understanding these structure-function relationships could provide insights for developing therapeutic approaches targeting specific CLDN12 functions without disrupting others .

How does post-translational modification affect bovine CLDN12 function and localization?

While direct data on bovine CLDN12 post-translational modifications is limited, studies on other claudins provide insight into potential regulatory mechanisms:

ModificationPotential EffectMethodological Approach
S-PalmitoylationMay affect protein stability and membrane localization, as seen with claudin-3 Acyl-biotin exchange assays, palmitoylation inhibitors, site-directed mutagenesis of cysteine residues
PhosphorylationCould regulate tight junction assembly and disassemblyPhosphoproteomic analysis, site-directed mutagenesis of potential phosphorylation sites, kinase inhibitor studies
UbiquitinationMay regulate protein turnover and stabilityProteasome inhibitor studies, ubiquitination assays, co-immunoprecipitation with ubiquitin

Research on claudin-3 demonstrated that S-palmitoylation is crucial for protein stability, with non-palmitoylated mutants undergoing accelerated degradation via the ubiquitin-proteasome pathway . Similar mechanisms may regulate bovine CLDN12, with important implications for experimental design when using recombinant proteins that lack these modifications .

How can recombinant bovine CLDN12 be used to develop diagnostic tools for calcium-related disorders?

Based on the role of CLDN12 in calcium homeostasis , several diagnostic applications could be developed:

  • Biomarker development:

    • Generate specific antibodies using recombinant bovine CLDN12

    • Develop ELISAs or other immunoassays to detect CLDN12 in serum or urine

    • Correlate CLDN12 levels with calcium metabolism disorders

  • Genetic screening tools:

    • Design PCR-based assays to identify mutations in the bovine CLDN12 gene

    • Develop functional assays using recombinant proteins to assess the impact of identified mutations

  • Imaging applications:

    • Develop labeled anti-CLDN12 antibodies for targeted imaging

    • Use in research settings to visualize CLDN12 expression patterns in tissues

These approaches could be particularly valuable for bovine calcium metabolism disorders or comparative studies with human conditions .

What are the key considerations for developing CLDN12-targeted therapeutics for cancer?

Research indicates CLDN12 involvement in cell migration and potential roles in metastasis , suggesting therapeutic potential:

  • Target validation:

    • Confirm CLDN12 overexpression in target cancer tissues

    • Validate functional role in invasion and metastasis models

    • Assess correlation between expression and patient outcomes

  • Therapeutic approach selection:

    • Antibody-based therapies: Develop antibodies that block CLDN12 function

    • Peptide inhibitors: Design peptides that compete with CLDN12 extracellular interactions

    • Small molecule modulators: Screen for compounds that alter CLDN12 conformation or interactions

  • Delivery challenges:

    • Tight junctions are typically located on the apical side of polarized epithelia

    • Consider targeting approaches that access CLDN12 before incorporation into tight junctions

    • Evaluate delivery systems that can reach metastatic cells

  • Specificity considerations:

    • Design therapeutics that distinguish CLDN12 from other claudin family members

    • Assess potential off-target effects on calcium homeostasis given CLDN12's role in calcium permeability

Experimental models using recombinant bovine CLDN12 can serve as valuable screening platforms for these therapeutic approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.