Recombinant Bovine Claudin-18 (CLDN18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your order.
Synonyms
CLDN18; Claudin-18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MSTTRCQVVGFLLSILGLAGCIVATEMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF TECRPYLTILGLPAMLQAVRALMIVGIVLSVIGLLVAIFALKCIRMGNMDDSAKAKMTLT SGIMFIIAGLCAIAGVSVFANMLVTNFWMSTASMFTSMGGMVQTVQTRYTFGAALFVGWV AGGLTLIGGVLMCIACRGLAPEETNYKAVSYHASGHNVAYRPGGFKASSGFESNTRNKKI YDGGARTEDEGQSPPSKYDYV
Uniprot No.

Target Background

Function
Claudin-18 plays a crucial role in the tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Database Links
Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is Claudin-18 and how does the bovine variant compare to human CLDN18?

Claudin-18 belongs to the claudin family of tight junction proteins characterized by four transmembrane domains and two extracellular loops. Human CLDN18 has an expected molecular mass of 27.9 kDa and exists in two isoforms (CLDN18.1 and CLDN18.2), which differ primarily in their N-terminal regions and tissue expression patterns . The bovine variant shares structural similarities with human CLDN18, featuring conserved extracellular loops that are crucial for tight junction formation. When designing experiments involving bovine CLDN18, researchers should note that while core functional domains are likely conserved across species, epitope recognition by antibodies may differ, requiring validation of detection methods specifically for bovine samples.

What are the known isoforms of bovine CLDN18 and their tissue distribution?

Similar to human CLDN18, bovine CLDN18 likely exists in multiple isoforms with distinct tissue distribution patterns. In humans, CLDN18.1 is strictly expressed in lung epithelial cells, while CLDN18.2 is confined to differentiated epithelial cells in the stomach (including mucous cells, parietal cells, and chief cells) . By extension, bovine CLDN18 would be expected to follow similar tissue-specific expression patterns, though species-specific variations may exist. When studying bovine CLDN18 isoforms, researchers should employ isoform-specific primers for RT-PCR and validated antibodies that can distinguish between the variants.

How can recombinant bovine CLDN18 be effectively produced and purified?

Production of recombinant bovine CLDN18 presents challenges typical of membrane proteins. Based on approaches used for human CLDN18, mammalian expression systems such as CHO-K1 cells are recommended over bacterial systems to ensure proper folding and post-translational modifications . For purification, researchers should consider:

  • Including affinity tags (His or FLAG) at termini least likely to interfere with protein function

  • Using mild detergents such as DDM (n-Dodecyl β-D-maltoside) for solubilization

  • Implementing a negative pre-selection step against non-expressing cells to enhance specificity

  • Verifying protein integrity through Western blotting and functional binding assays

Expression SystemAdvantagesConsiderations
CHO-K1 cellsProper folding, PTMsLonger production time, higher cost
HEK293 cellsHigh transfection efficiencyMay have different glycosylation patterns
Insect cellsHigher yield for membrane proteinsDifferent post-translational modifications
E. coliRapid, cost-effectiveRisk of improper folding, lack of PTMs

What structural features define bovine CLDN18 and how do they relate to function?

Bovine CLDN18, like other claudin family members, is expected to feature four transmembrane domains with two extracellular loops (loop 1 and loop 2) and cytoplasmic N- and C-termini . The first extracellular loop contains charged amino acids that create selective paracellular ion channels, while the second loop is involved in claudin-claudin interactions between adjacent cells. The C-terminal domain likely contains PDZ-binding motifs that interact with cytoplasmic scaffolding proteins. Understanding these structural elements is essential for designing functional studies, as mutations in these regions can significantly alter barrier properties and protein-protein interactions.

How do the two isoforms of CLDN18 differ functionally in bovine tissues?

Based on human studies, bovine CLDN18.1 and CLDN18.2 would differ by approximately 21 amino acids among the first 69 amino acids at the N-terminus, with only about 8 amino acid differences in the extracellular domain 1 . These differences likely confer tissue-specific functions—CLDN18.1 contributing to the alveolar barrier in lungs, while CLDN18.2 helps maintain gastric epithelial integrity. Researchers investigating isoform-specific functions should design experiments that can distinguish between these variants through targeted antibodies or genetic approaches that selectively modify each isoform.

What methodologies are appropriate for assessing bovine CLDN18 function in tight junction formation?

To evaluate bovine CLDN18's role in tight junction formation, researchers can employ several complementary approaches:

  • Transepithelial electrical resistance (TEER) measurements in polarized bovine epithelial cells

  • Paracellular flux assays using fluorescently labeled dextrans of various molecular weights

  • Immunofluorescence microscopy to visualize co-localization with other tight junction proteins

  • Freeze-fracture electron microscopy to examine tight junction strand morphology

  • FRAP (Fluorescence Recovery After Photobleaching) analysis to study CLDN18 dynamics

When interpreting results, consider that CLDN18 does not function in isolation but as part of a complex that includes other claudins, occludin, ZO proteins, and the actin cytoskeleton.

What are the optimal conditions for detecting bovine CLDN18 using immunological methods?

For effective immunodetection of bovine CLDN18, consider the following optimization strategies:

  • For Western blotting, ensure complete solubilization of this membrane protein using appropriate detergents (e.g., 1% SDS or Triton X-100), avoid boiling samples (heat to 37°C instead), and use gradient gels (4-12%) for better resolution.

  • For immunohistochemistry, test multiple antigen retrieval methods, as membrane proteins often require specialized retrieval (citrate buffer, pH 6.0, or EDTA buffer, pH 9.0). Perfusion fixation of tissues may better preserve tight junction architecture compared to immersion fixation.

  • For flow cytometry, gentle cell dissociation methods and careful optimization of permeabilization conditions are essential to maintain epitope integrity while allowing antibody access.

When selecting antibodies, those targeting the extracellular loops may recognize native protein in non-permeabilized samples, while antibodies to cytoplasmic domains require permeabilization .

How can CRISPR-Cas9 genome editing be optimized for studying bovine CLDN18 function?

For CRISPR-Cas9 editing of bovine CLDN18:

  • Design multiple guide RNAs targeting conserved exons using bovine-specific genomic sequences.

  • Consider the genomic organization to avoid unintended effects on neighboring genes.

  • For isoform-specific studies, target unique exons of CLDN18.1 or CLDN18.2.

  • Validate editing efficiency in bovine cell lines before moving to primary cells.

  • For knock-in studies, use homology-directed repair with templates containing silent mutations to prevent re-cutting.

Phenotypic analysis should examine tight junction integrity, barrier function, and cell morphology using immunofluorescence, TEER measurements, and paracellular flux assays. Always sequence the target region to confirm the intended edit and rule out off-target effects.

What approaches are recommended for studying CLDN18 interactions with other tight junction proteins?

To investigate bovine CLDN18 interactions with other junction proteins:

  • Co-immunoprecipitation using antibodies specific to bovine CLDN18, followed by mass spectrometry to identify binding partners.

  • Proximity ligation assays to visualize protein-protein interactions in situ with nanometer resolution.

  • FRET (Förster Resonance Energy Transfer) or BiFC (Bimolecular Fluorescence Complementation) to study direct protein interactions in living cells.

  • Surface plasmon resonance or biolayer interferometry with the protein reconstituted in nanodiscs for quantitative binding kinetics.

Control experiments should include non-specific binding controls and validation with mutant variants to confirm specificity .

How can recombinant bovine CLDN18 be utilized in comparative oncology studies?

Recent research has identified CLDN18.2 as an attractive target for cancer therapeutics, particularly in gastric and pancreatic cancers where it is abnormally expressed . Bovine CLDN18 can serve as a valuable comparative model to understand evolutionarily conserved mechanisms of tight junction dysregulation in cancer. Researchers can:

  • Compare expression patterns of CLDN18.2 in bovine and human tumor samples.

  • Develop cross-species reactive antibodies that recognize conserved epitopes.

  • Test therapeutic antibodies against human CLDN18.2 for cross-reactivity with bovine CLDN18.2.

  • Establish bovine cell models expressing CLDN18.2 for preliminary screening of therapeutic approaches.

This comparative approach may reveal conserved regulatory mechanisms and potential therapeutic targets while providing insights into species-specific differences that could impact translational research.

What strategies can overcome poor expression yield of recombinant bovine CLDN18?

Poor expression yield of bovine CLDN18 can be addressed through several optimization strategies:

  • Codon optimization for the expression host system to enhance translation efficiency.

  • Fusion partners known to enhance membrane protein expression (SUMO, MBP, Trx).

  • Lower expression temperature (28-30°C) to facilitate proper folding.

  • Addition of chemical chaperones (glycerol, arginine) to the culture medium.

  • Use of specialized cell lines engineered for membrane protein expression.

  • Controlled induction protocols with variable inducer concentrations.

For stable expression, consider a dual selection system and clonal selection to identify high-expressing cell populations. Monitoring protein expression through a C-terminal GFP tag can help identify optimal conditions without disrupting the N-terminal signal sequence .

How can species-specific differences in CLDN18 be leveraged for structure-function studies?

Comparing bovine and human CLDN18 sequences can reveal conserved regions that likely serve critical functions versus variable regions that may confer species-specific properties. Researchers can:

  • Conduct detailed sequence analysis to identify conserved motifs across species.

  • Create chimeric proteins exchanging domains between bovine and human CLDN18 to map functional regions.

  • Perform site-directed mutagenesis of divergent residues to understand their contributions to function.

  • Use molecular dynamics simulations to predict how sequence differences might affect protein conformation and interactions.

This comparative approach can identify essential structural elements required for tight junction formation while revealing species-specific adaptations that may relate to physiological differences between bovines and humans .

How can cross-reactivity issues between bovine CLDN18 isoforms be managed in experimental design?

Managing cross-reactivity between bovine CLDN18 isoforms requires careful consideration of their structural similarities and differences:

  • Design isoform-specific detection tools targeting unique regions, particularly the N-terminal domain where CLDN18.1 and CLDN18.2 differ by approximately 21 amino acids .

  • Validate antibody specificity using recombinant proteins of each isoform expressed in the same system.

  • Employ isoform-specific PCR primers that span junction regions unique to each variant.

  • Use immunohistochemistry controls from tissues known to exclusively express one isoform (lung for CLDN18.1, stomach for CLDN18.2).

  • Consider developing knockout or knockdown systems specific to each isoform for biological validation.

When interpreting results, always include appropriate controls to distinguish isoform-specific effects from general claudin functions.

What quality control methods ensure the functionality of purified recombinant bovine CLDN18?

Quality control for recombinant bovine CLDN18 should address both structural integrity and functional activity:

  • Purity assessment: SDS-PAGE with Coomassie staining and Western blotting

  • Structural integrity: Circular dichroism to confirm secondary structure retention; size-exclusion chromatography to assess oligomeric state

  • Homogeneity: Dynamic light scattering to verify monodispersity

  • Thermal stability: Differential scanning fluorimetry to determine melting temperature

  • Functional validation: Binding assays with known interaction partners; liposome incorporation studies to assess membrane integration

For membrane proteins like CLDN18, functional validation is particularly important, as proper folding and activity depend on the lipid environment. Consider reconstitution into lipid nanodiscs or proteoliposomes for functional studies .

How does post-translational modification affect bovine CLDN18 function, and how can these modifications be characterized?

Post-translational modifications (PTMs) likely play crucial roles in regulating bovine CLDN18 function, similar to other claudins. These modifications can affect protein localization, stability, and interactions. To characterize PTMs:

  • Use mass spectrometry (LC-MS/MS) after enrichment strategies for specific modifications (phosphopeptide enrichment, glycopeptide isolation).

  • Employ site-directed mutagenesis of predicted modification sites followed by functional assays.

  • Apply modification-specific antibodies (anti-phospho, anti-glyco) in Western blotting or immunoprecipitation.

  • Consider the impact of expression systems on PTM patterns—mammalian cells will provide more native-like modifications than bacterial systems.

Common regulatory PTMs for claudins include phosphorylation (affecting tight junction assembly/disassembly), palmitoylation (influencing membrane localization), and ubiquitination (controlling protein turnover) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.