Recombinant Bovine Claudin-2 (CLDN2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CLDN2; Claudin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
CLDN2
Target Protein Sequence
MASLGLQLVGYVLGLLGLLGTVIAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTG ITQCDIYSTMLGLPADIQAAQAMMVTSSAMSSLACIVSVVGMRCTVFFQESRAKDRVAVV GGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIF LCFSCSPQGNRSNYYDAYQAQPLATRSSPRPGQAPKGKSEFNSYSLTGYV
Uniprot No.

Target Background

Function
Claudin-2 plays a crucial role in the tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Database Links

KEGG: bta:404089

STRING: 9913.ENSBTAP00000006960

UniGene: Bt.3242

Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is Claudin-2 and what is its primary function in cellular physiology?

Claudin-2 is a critical tight junction (TJ) protein that forms cation-selective pores between epithelial cells. While traditionally recognized for its role in regulating paracellular permeability, research has established that Claudin-2 has functions extending beyond simple barrier regulation. It participates in cellular signaling pathways that affect cell behavior, highlighting its multifunctional nature in tissue physiology . Understanding these broader functions is essential when using recombinant bovine Claudin-2 as a research tool to investigate tight junction biology.

What is the molecular weight of Claudin-2 protein and how does it compare between species?

The calculated molecular weight of human Claudin-2 is 25 kDa, with the observed molecular weight in Western blot analyses also being approximately 25 kDa . While bovine Claudin-2 may exhibit slight species-specific variations, the core structure and molecular weight remain relatively conserved across mammalian species. This conservation facilitates cross-species experimental approaches when working with the recombinant protein.

How does Claudin-2 interact with other claudin family members?

Claudin-2 exhibits specific heterotypic trans-interactions with other claudin family members. Research has demonstrated that Claudin-2 can bind to Claudin-3 on neighboring cells but does not interact with Claudin-1 . Additionally, an antagonistic relationship exists between Claudin-2 and both Claudin-4 and Claudin-8. Fluorescence recovery after photobleaching (FRAP) analysis revealed that Claudin-2 and Claudin-4 compete for residency at tight junctions, while Claudin-8 can displace Claudin-2 from junctions, resulting in elevated transepithelial resistance . These interaction patterns should be considered when designing experiments using recombinant bovine Claudin-2.

What are the recommended methods for detecting recombinant bovine Claudin-2 in experimental systems?

Several validated methods exist for detecting Claudin-2 protein:

  • Western Blot (WB): The recommended dilution range is 1:500-1:2000 for antibodies targeting Claudin-2 . A standard protocol involves:

    • Loading 20-40 μg of cell lysate or 40 ng of recombinant Claudin-2

    • Separation on 4-12% Bis-Tris gels

    • Transfer to nitrocellulose membrane

    • Blocking with 4% milk powder

    • Primary antibody incubation overnight at 4°C

    • Detection with appropriate HRP-conjugated secondary antibodies

  • Immunofluorescence (IF): For cellular localization studies, grow cells to confluence, fix with ice-cold methanol, block with 2% BSA, and incubate with anti-Claudin-2 primary antibody followed by fluorophore-conjugated secondary antibody .

  • ELISA: Validated for quantitative detection of Claudin-2 expression levels .

How should recombinant bovine Claudin-2 protein be stored to maintain stability and activity?

Based on established protocols for Claudin-2 antibodies and proteins, the recommended storage conditions for recombinant bovine Claudin-2 are:

  • Store at -20°C

  • The protein remains stable for one year after shipment when properly stored

  • Aliquoting is generally unnecessary for -20°C storage

  • For buffer composition, PBS with 0.02% sodium azide and 50% glycerol at pH 7.3 is typically used

These conditions help maintain protein stability and prevent freeze-thaw cycles that could compromise functional integrity.

What cell lines or experimental models are most appropriate for studying recombinant bovine Claudin-2 function?

Several validated cell lines have demonstrated reliable Claudin-2 expression and are suitable for functional studies:

Cell LineOriginApplicationsReference
Caco-2Human colorectal adenocarcinomaBarrier function, permeability studies
HT-29Human colorectal adenocarcinomaWestern blot detection
LLC-PK1Porcine kidney epithelialExpression regulation studies
A549Human lung carcinomaWestern blot validation
HEK-293Human embryonic kidneyWestern blot validation
HepG2Human liver carcinomaWestern blot validation
PANC-1Human pancreatic carcinomaWestern blot validation

The choice of cell line should align with your specific research question, considering tissue origin and endogenous Claudin-2 expression levels.

How can the barrier function effects of recombinant bovine Claudin-2 be measured in cell culture models?

The gold standard for measuring Claudin-2-mediated changes in barrier function is transepithelial electrical resistance (TER). This involves:

  • Growing epithelial cells (e.g., Caco-2) on permeable filter supports until confluence

  • Allowing monolayers to differentiate for at least 14 days or until reaching TER values of ≥300 Ω·cm²

  • Treating with recombinant Claudin-2 or experimental conditions

  • Measuring TER using epithelial volt-ohm meters to detect changes in ionic permeability

Interestingly, despite Claudin-2 forming cation-selective pores, paradoxical effects have been observed where increased Claudin-2 expression does not necessarily decrease barrier function . These complex relationships should be considered when interpreting experimental results.

What signaling pathways are known to regulate Claudin-2 expression and function?

Several signaling pathways have been established to regulate Claudin-2 expression:

  • Cytokine Regulation: TNFα has differential effects on Claudin-2 expression depending on treatment duration and cell type. In tubular and intestinal cell lines, short-term vs. long-term TNFα exposure produces opposite effects .

  • Growth Factor Pathways: EGF affects the Claudin-2 promoter differently in Caco-2 colon cancer cells compared to MDCK tubular epithelial cells .

  • TGF-β Signaling: Bovine colostrum increases TGF-β expression, which may compensate for increased Claudin-2 expression to maintain barrier integrity .

  • CLDN2/ZO1/ZONAB Complex: In colorectal cancer research, CLDN2 depletion promotes N-myc downstream-regulated gene 1 (NDRG1) transcription by causing CLDN2/ZO1/ZONAB complex dissociation and ZONAB shuttle into the nucleus .

Understanding these pathways is crucial when designing experiments to modulate Claudin-2 function or expression using recombinant protein.

How can recombinant bovine Claudin-2 be utilized in studying inflammatory bowel disease (IBD) mechanisms?

Claudin-2 has emerged as a potential biomarker in IBD research, particularly in ulcerative colitis. Researchers have developed and validated an in situ hybridization assay for Claudin-2 suitable for use on formalin-fixed paraffin-embedded sections of colon biopsies . This approach allows for:

  • Measurement of Claudin-2 expression in patient samples

  • Correlation of expression levels with disease severity (Geboes score)

  • Evaluation of target engagement in therapeutic trials

Using recombinant bovine Claudin-2 as a standard in these assays can help establish quantitative measurements and validate antibody specificity, critical for reliable biomarker development in translational IBD research .

What role does Claudin-2 play in cancer progression, and how might recombinant protein be used in oncology research?

Claudin-2 (CLDN2) has been implicated in colorectal cancer (CRC) progression through several mechanisms:

  • CLDN2 is significantly upregulated in CRC samples and associated with poor patient survival

  • CLDN2 depletion promotes NDRG1 transcription, inhibiting cancer growth and metastasis

  • Mechanistically, CLDN2 knockdown promotes CLDN2/ZO1/ZONAB complex dissociation, resulting in ZONAB relocation to the nucleus

  • This pathway regulates epithelial-mesenchymal transition (EMT) and expression of cyclin-dependent kinase inhibitors

Recombinant bovine Claudin-2 could be utilized in structural studies, protein-protein interaction assays, or as a competitive inhibitor to disrupt Claudin-2 complexes in cancer cells, potentially offering new therapeutic strategies targeting the CLDN2/ZO1/ZONAB-NDRG1 axis.

How do experimental variables affect Claudin-2 expression in cell culture systems?

Several critical variables influence Claudin-2 expression in experimental systems and should be carefully controlled:

  • Cell Confluence: In LLC-PK1 tubular cells, Claudin-2 expression is low in subconfluent cultures and increases as confluence is established .

  • Treatment Duration: The effect of cytokines like TNFα on Claudin-2 expression can be opposite depending on the length of treatment .

  • Cell Passage Number: Expression patterns may change with increased passage of cell lines.

  • Culture Conditions: Medium composition, supplements, and culture surfaces can significantly impact Claudin-2 expression and localization.

Researchers should standardize these variables and clearly report them to ensure experimental reproducibility when working with recombinant bovine Claudin-2.

What are the potential cross-reactivity concerns when using antibodies against recombinant bovine Claudin-2?

When detecting recombinant bovine Claudin-2, antibody cross-reactivity must be considered:

  • Most commercially available antibodies have been validated for human, mouse, and rat Claudin-2 , but bovine reactivity should be specifically verified.

  • The development and validation of target-specific antibodies for formalin-fixed samples is challenging, as published antibodies may not correctly identify the intended antigen in tissues fixed using standard methods .

  • When selecting antibodies, confirm species reactivity and validation for your specific application (WB, IF, ELISA) and sample preparation method.

To minimize issues, include positive controls (such as recombinant human GST-tagged Claudin-2) in experimental protocols .

How can researchers distinguish between the effects of endogenous and recombinant bovine Claudin-2 in experimental systems?

To differentiate between endogenous and recombinant Claudin-2 effects:

  • Tagged Recombinant Protein: Utilize recombinant bovine Claudin-2 with epitope tags (His, GST, FLAG) that allow specific detection separate from endogenous protein.

  • Species-Specific Antibodies: When working across species barriers, use antibodies that specifically recognize bovine but not human/mouse Claudin-2.

  • CRISPR/Cas9 Knockout Background: Generate Claudin-2 knockout cell lines where only the recombinant protein is present, eliminating background effects.

  • Dose-Response Studies: Perform careful titration experiments with recombinant protein to distinguish concentration-dependent effects from endogenous background.

These approaches help establish causality between recombinant protein addition and observed experimental outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.