Recombinant Bovine Claudin-7 (CLDN7)

Shipped with Ice Packs
In Stock

Description

Production and Purification

While specific protocols for bovine CLDN7 are not detailed in the literature, recombinant production typically involves:

  1. Gene cloning: Bovine CLDN7 cDNA is inserted into expression vectors (e.g., bacterial, mammalian, or insect systems).

  2. Transfection: Host cells (e.g., HEK293, CHO) are engineered to express the protein.

  3. Purification: Affinity chromatography (e.g., His-tag systems) isolates the protein.

Quality control: Confirmed via SDS-PAGE, Western blot (using antibodies like Thermo Fisher PA5-32356 ), and mass spectrometry.

Functional Roles Inferred from Ortholog Studies

Key roles identified in human/mouse models provide insights into bovine CLDN7’s potential functions:

FunctionMechanismSupporting Evidence
Epithelial barrier maintenanceRegulates paracellular Cl⁻/Na⁺ permeabilityRenal studies in mice
Cancer modulationOverexpressed in ovarian tumors; impacts Erk/Raf-1 signalingOvarian cancer models
Intestinal homeostasisEssential for crypt stem cell survival via Wnt/β-cateninKnockout mouse studies
Inflammatory regulationDeficiency exacerbates colitis and tumorigenesisColitis-associated cancer models

Antibody Development

Recombinant bovine CLDN7 serves as an antigen for generating cross-reactive antibodies validated in:

  • Immunohistochemistry (e.g., colon carcinoma)

  • Western blotting (detects ~25 kDa band)

Disease Modeling

Used to study:

  • Intestinal disorders: CLDN7 loss causes epithelial sloughing and inflammation

  • Renal pathologies: Alters WNK4 and ENaC expression, affecting salt homeostasis

Drug Screening

High-throughput platforms utilize recombinant CLDN7 to test TJ-modulating compounds.

Key Research Findings

  • Ovarian cancer: CLDN7 knockdown reduces transepithelial resistance (TER) by 60% and increases invasion in OVCAR-2 cells .

  • Colorectal cancer: CLDN7-deficient mice show 59.7% tumor incidence (>4 mm) vs. 46.7% in controls .

  • Renal function: CLDN7 deletion elevates WNK4 mRNA by 3.2-fold and ENaC-α by 2.1-fold in collecting duct cells .

Challenges and Future Directions

  • Species-specific variability: Functional differences between bovine and human CLDN7 remain underexplored.

  • Therapeutic targeting: Conflicting roles in cancer (pro- vs. anti-tumorigenic) require resolution .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CLDN7; Claudin-7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLSLPAALQATRALMVVSLVLGFLATFVATMGMKCTNCGGDDKVKKARIAM TGGIIFILAGLAALIACSWYGHQIVSDFYNPLVPMNVKYEFGPAIFIGWAGSALVLLGGA LLSCSCPGSESKAGYRAPRSYPKPNSAKEYV
Uniprot No.

Target Background

Function
Claudin-7 plays a significant role in the tight junction-mediated obliteration of the intercellular space.
Database Links
Protein Families
Claudin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane. Cell junction, tight junction.

Q&A

What is Claudin-7 and what cellular functions does it perform in bovine tissues?

Claudin-7 (CLDN7) is a transmembrane protein that serves as a crucial component of tight junctions (TJs) in epithelial tissues. In bovine tissues, as in other mammals, CLDN7 plays a significant role in maintaining cell polarity and regulating cell permeability. Unlike some other claudin family members that are strictly localized to tight junctions, CLDN7 can be found both in tight junctions and along the basolateral membrane of epithelial cells. This distribution pattern suggests additional functions beyond traditional barrier formation. CLDN7 is particularly abundant in intestinal, renal, and mammary epithelial tissues in bovines, where it helps establish and maintain tissue-specific barrier properties .

How do recombinant bovine CLDN7 proteins differ from native bovine CLDN7 in structure and function?

Recombinant bovine CLDN7 proteins are laboratory-produced versions designed to mimic the native CLDN7 protein. These recombinant proteins are typically produced in expression systems such as E. coli, yeast, baculovirus, or mammalian cell cultures, with purity levels typically exceeding 85% as determined by SDS-PAGE analysis . While recombinant bovine CLDN7 preserves the primary amino acid sequence of the native protein, subtle differences may exist in post-translational modifications depending on the expression system used. For example, recombinant CLDN7 produced in E. coli lacks glycosylation patterns that might be present in native bovine CLDN7. Additionally, the palmitoylation status—which affects CLDN7's membrane localization and protein-protein interactions—may differ between recombinant and native proteins. These differences should be considered when using recombinant CLDN7 as a model for functional studies, as they may influence protein folding, stability, and interaction capabilities .

What are the standard validation methods to confirm the identity and activity of recombinant bovine CLDN7?

Validating recombinant bovine CLDN7 requires multiple complementary approaches:

  • Structural validation:

    • SDS-PAGE and Western blotting to confirm molecular weight (~22 kDa)

    • Mass spectrometry for precise peptide mass fingerprinting

    • Circular dichroism to assess secondary structure elements

  • Functional validation:

    • Binding assays with known CLDN7 interaction partners

    • Membrane incorporation studies using artificial lipid bilayers

    • Barrier formation assessment in epithelial cell lines

  • Immunological validation:

    • Reactivity with anti-CLDN7 antibodies via ELISA or immunoblotting

    • Epitope mapping to confirm preservation of key antigenic regions

For comprehensive validation, researchers should compare the recombinant protein's properties with those of native CLDN7 from bovine tissues using techniques such as co-immunoprecipitation, immunofluorescence localization, and functional barrier assays in reconstituted systems .

How should researchers design experiments to study bovine CLDN7's role in tight junction formation?

When designing experiments to study bovine CLDN7's role in tight junction formation, researchers should implement multi-faceted approaches:

  • Cell culture models:

    • Bovine epithelial cell lines (e.g., MDBK, mammary epithelial cells)

    • Transfection with recombinant CLDN7 or CLDN7 siRNA/shRNA

    • Measuring transepithelial electrical resistance (TEER) to assess barrier integrity

    • Paracellular permeability assays using molecular tracers of different sizes

  • Organoid models:

    • Generate bovine intestinal organoids as demonstrated in mouse models

    • Compare organoid formation efficiency and diameter between wild-type and CLDN7-deficient conditions

    • Assess stem cell and differentiation marker genes via qRT-PCR

  • Imaging approaches:

    • Immunofluorescence to visualize CLDN7 localization with respect to other TJ proteins

    • Super-resolution microscopy to analyze nanoscale architecture of TJ strands

    • FRAP (Fluorescence Recovery After Photobleaching) to study CLDN7 dynamics

  • Interaction studies:

    • Co-immunoprecipitation to identify CLDN7 binding partners

    • Proximity ligation assays to confirm in situ protein-protein interactions

    • FRET/BRET to assess dynamic interactions in living cells

Control experiments should include comparisons with other claudin family members (especially claudin-1, -3, and -4) to determine CLDN7-specific effects, and rescue experiments where CLDN7 expression is restored in knockout or knockdown models .

What are the optimal conditions for incorporating recombinant bovine CLDN7 in artificial membrane systems?

Incorporating recombinant bovine CLDN7 into artificial membrane systems requires careful optimization:

Table 1: Optimal Conditions for CLDN7 Incorporation in Artificial Membranes

ParameterOptimal RangeConsiderations
pH7.2-7.4Maintains native conformation
Temperature25-30°CBalances incorporation efficiency with protein stability
Lipid CompositionPC/PE/PS/Cholesterol (5:3:1:1)Mimics mammalian cell membranes
Detergentn-Dodecyl-β-D-maltoside (0.1-0.5%)Effective for CLDN7 solubilization with minimal denaturation
Protein:Lipid Ratio1:100 to 1:1000 (w/w)Depends on experimental goals
Buffer50 mM Tris-HCl, 150 mM NaCl, 1 mM CaCl₂Supports protein stability and membrane formation

For successful incorporation:

  • Ensure recombinant CLDN7 maintains its transmembrane domains during purification

  • Pre-solubilize the protein in mild detergents before membrane incorporation

  • Remove detergent gradually using Bio-Beads or dialysis

  • Verify incorporation using freeze-fracture electron microscopy or AFM

  • Confirm functional reconstitution through electrophysiological measurements

Critical controls should include non-functional CLDN7 mutants and other claudin family members to assess specificity of observed effects .

How can researchers effectively use recombinant bovine CLDN7 to study intestinal barrier function in vitro?

To effectively study intestinal barrier function using recombinant bovine CLDN7 in vitro, researchers should implement comprehensive methodological approaches:

  • Transwell culture systems:

    • Seed bovine intestinal epithelial cells on permeable supports

    • Supplement with recombinant CLDN7 or manipulate endogenous CLDN7 expression

    • Monitor barrier development via TEER measurements over 14-21 days

    • Assess paracellular permeability using differently sized molecular tracers

  • Intestinal organoid models:

    • Establish bovine intestinal organoids from crypts

    • Compare organoid formation, morphology, and barrier properties between conditions

    • Measure crypt isolation efficiency, organoid diameter, and secondary organoid formation ability

    • Quantify expression of stem cell and differentiation markers via qRT-PCR

  • Barrier challenge experiments:

    • Expose models to barrier disruptors (cytokines, pathogens, toxins)

    • Determine if recombinant CLDN7 supplementation provides protective effects

    • Assess recovery dynamics after barrier disruption

    • Analyze inflammatory responses via cytokine measurements

  • Mechanistic investigations:

    • Use domain-specific CLDN7 antibodies to block particular protein regions

    • Compare wild-type vs. mutated CLDN7 proteins lacking key functional domains

    • Analyze CLDN7 interactions with scaffold proteins like ZO-1 and EpCAM

Researchers should include relevant controls such as claudin-7 knockdown/knockout models and rescue experiments with recombinant CLDN7 to establish causality in observed barrier effects .

How does bovine CLDN7 interact with other tight junction proteins and what techniques best capture these interactions?

Bovine CLDN7 engages in complex interactions with multiple tight junction and adhesion proteins. These interactions can be effectively studied using various complementary techniques:

  • Protein-Protein Interaction Techniques:

    • Co-immunoprecipitation (Co-IP): Captures stable interactions between CLDN7 and partners like ZO-1, ZO-2, and other claudins

    • Proximity Ligation Assay (PLA): Detects in situ interactions within 40 nm in fixed cells or tissues

    • FRET/BRET: Measures real-time interactions in living cells with nanometer resolution

    • Crosslinking Mass Spectrometry (XL-MS): Identifies interaction interfaces at amino acid resolution

    • Yeast Two-Hybrid (Y2H): Screens for novel interaction partners using specific CLDN7 domains

  • Structural Analysis Methods:

    • Cryo-EM: Reveals 3D architecture of CLDN7-containing complexes

    • X-ray Crystallography: Provides atomic-level details of CLDN7 interactions (challenging but valuable)

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Maps interaction interfaces and conformational changes

  • Functional Validation Approaches:

    • Mutagenesis Studies: Identify critical residues in CLDN7 required for specific protein interactions

    • Competitive Binding Assays: Determine binding hierarchies among interaction partners

    • Domain Truncation Experiments: Map interaction domains within CLDN7

Research indicates that CLDN7 forms homotypic interactions with itself and heterotypic interactions with other claudins, particularly claudin-1 and claudin-3. Additionally, CLDN7 uniquely interacts with EpCAM (Epithelial Cell Adhesion Molecule) outside of tight junctions, forming complexes in glycolipid-rich membrane microdomains. This interaction appears crucial for maintaining epithelial integrity beyond classical tight junction functions .

What are the methodological challenges in studying phosphorylation states of recombinant bovine CLDN7 and how can they be addressed?

Studying phosphorylation states of recombinant bovine CLDN7 presents several methodological challenges that require specific technical solutions:

Table 2: Challenges and Solutions for CLDN7 Phosphorylation Analysis

ChallengeTechnical ImpactSolution Approach
Multiple phosphorylation sitesComplex phosphorylation patterns difficult to characterizeUse phospho-specific antibodies for known sites; employ mass spectrometry for unbiased site mapping
Low abundance of phosphorylated formsReduced detection sensitivityImplement phospho-enrichment techniques (TiO₂, IMAC, phospho-antibody enrichment)
Expression system limitationsE. coli-produced protein lacks mammalian PTMsUse mammalian or insect cell expression systems with appropriate kinases
Dynamic phosphorylation statesTemporal changes difficult to captureEmploy pulse-chase experiments with phosphate labeling; use phosphatase inhibitors during purification
Site-specific functional effectsDifferent sites may have opposing effectsCreate phosphomimetic (S/T→D/E) and phospho-deficient (S/T→A) mutants for functional testing

For comprehensive analysis, researchers should:

  • Identify potential phosphorylation sites through in silico predictions (NetPhos, GPS) and literature mining

  • Express recombinant CLDN7 in mammalian cells to preserve physiological phosphorylation

  • Use quantitative phosphoproteomics approaches (SILAC, TMT labeling) to measure site-specific phosphorylation levels

  • Correlate phosphorylation status with functional outcomes (barrier integrity, protein localization)

  • Identify specific kinases and phosphatases regulating CLDN7 through inhibitor studies and in vitro assays

The most common phosphorylation sites in claudin-7 occur on serine and threonine residues within the C-terminal cytoplasmic domain, which can modulate interactions with scaffold proteins like ZO-1 and affect tight junction assembly and disassembly kinetics .

How can researchers design experiments to investigate the role of bovine CLDN7 in pathological conditions such as inflammatory bowel disease models?

Designing experiments to investigate bovine CLDN7's role in inflammatory bowel disease (IBD) models requires systematic approaches across multiple experimental systems:

  • In vitro inflammatory models:

    • Establish bovine intestinal epithelial cell monolayers with controlled CLDN7 expression

    • Challenge with pro-inflammatory cytokines (TNF-α, IFN-γ, IL-1β) to simulate IBD conditions

    • Measure barrier function via TEER and permeability assays before/during/after challenge

    • Analyze CLDN7 expression, localization, and phosphorylation status during inflammation

    • Determine if recombinant CLDN7 supplementation mitigates barrier dysfunction

  • Ex vivo tissue explant approaches:

    • Culture bovine colonic tissue explants with normal or reduced CLDN7 expression

    • Induce inflammation using DSS, TNBS, or bacterial components (LPS)

    • Assess epithelial integrity, inflammatory markers, and bacterial translocation

    • Perform rescue experiments with recombinant CLDN7 administration

  • Organoid inflammation models:

    • Generate bovine intestinal organoids as demonstrated in mouse models

    • Manipulate CLDN7 expression via genetic approaches

    • Challenge with inflammatory mediators and measure organoid integrity

    • Compare organoid formation efficiency, diameter, and marker gene expression

  • Translational approaches:

    • Analyze CLDN7 expression in bovine tissue samples from animals with naturally occurring intestinal inflammation

    • Correlate CLDN7 levels with disease severity, bacterial translocation, and inflammatory markers

    • Validate findings from model systems in actual disease specimens

Mouse model studies have demonstrated that intestinal claudin-7 knockout results in severe intestinal inflammation, increased epithelial cell apoptosis, neutrophil infiltration, elevated proinflammatory cytokine expression, and compromised barrier function. These models show intestinal microorganisms entering epithelial cells through transcellular pathways, promoting inflammation that can lead to tumor development. This supports the hypothesis that CLDN7 plays a protective role in maintaining intestinal barrier function and preventing inflammation-associated pathologies .

How do expression patterns and functions of bovine CLDN7 compare with human and murine CLDN7?

Comparative analysis of CLDN7 across bovine, human, and murine species reveals important similarities and differences in expression patterns, structure, and function:

Table 3: Comparative Analysis of CLDN7 Across Species

CharacteristicBovine CLDN7Human CLDN7Murine CLDN7
Amino Acid Sequence HomologyReference~93% identity with bovine~88% identity with bovine
Molecular Weight~22 kDa~22 kDa~22 kDa
Primary Tissue ExpressionIntestine, kidney, mammary glandIntestine, kidney, airway epitheliaIntestine, kidney, lung
Subcellular LocalizationTJs and basolateral membraneTJs and basolateral membraneTJs and basolateral membrane
Interaction with EpCAMPresentPresentPresent
Knockout PhenotypeNot fully characterizedN/A (cell line studies)Lethal within 10 days (general KO); severe intestinal inflammation (conditional KO)
Role in CancerNot well-studiedDual role (pro-tumorigenic and tumor suppressive)Tumor suppressor in intestinal models

While the basic structure and function of CLDN7 are conserved across species, notable differences exist:

  • Expression patterns: Human CLDN7 shows more widespread expression in stratified epithelia compared to bovine and murine CLDN7.

  • Regulatory mechanisms: Species-specific differences exist in the promoter regions, suggesting divergent transcriptional regulation.

  • Functional roles: In human colorectal cancer, CLDN7 exhibits a dual role—sometimes acting as a tumor suppressor and other times as a promoter of tumorigenesis. This duality is supported by studies showing reduced CLDN7 expression in some CRC tissues and increased expression in others .

  • Interaction networks: While core interactions with tight junction proteins are conserved, species-specific binding partners may exist, particularly in specialized tissues.

Mouse model studies have provided crucial insights into CLDN7 function, demonstrating that general knockout is lethal within 10 days of birth, while intestine-specific knockout leads to severe colitis, increased epithelial permeability, and susceptibility to tumorigenesis—findings that likely have relevance for understanding bovine CLDN7 function .

What analytical methods are most appropriate for quantifying the binding kinetics between recombinant bovine CLDN7 and potential interaction partners?

Quantifying binding kinetics between recombinant bovine CLDN7 and its interaction partners requires specialized techniques appropriate for membrane proteins:

  • Surface Plasmon Resonance (SPR):

    • Immobilize recombinant CLDN7 in supported lipid bilayers or detergent micelles

    • Flow potential binding partners across the surface

    • Measure association (k₁) and dissociation (k₋₁) rate constants

    • Calculate equilibrium dissociation constant (KD = k₋₁/k₁)

    • Advantages: Label-free, real-time kinetics, low sample consumption

    • Limitations: Proper orientation of CLDN7 can be challenging

  • Microscale Thermophoresis (MST):

    • Label recombinant CLDN7 with fluorescent dye

    • Mix with varying concentrations of binding partners

    • Measure changes in thermophoretic mobility upon binding

    • Calculate binding affinities from concentration-dependent changes

    • Advantages: Works well with membrane proteins in detergent micelles or nanodiscs

    • Limitations: Requires fluorescent labeling

  • Bio-Layer Interferometry (BLI):

    • Immobilize biotinylated CLDN7 on streptavidin sensors

    • Measure wavelength shifts during association/dissociation phases

    • Calculate binding parameters from sensorgrams

    • Advantages: No microfluidics required, good for screening multiple partners

    • Limitations: Lower sensitivity than SPR

  • Isothermal Titration Calorimetry (ITC):

    • Measure heat changes during binding events

    • Determine thermodynamic parameters (ΔH, ΔS) along with KD

    • Advantages: Label-free, provides complete thermodynamic profile

    • Limitations: Requires larger sample amounts, challenging with detergent-solubilized proteins

For transmembrane proteins like CLDN7, maintaining native-like membrane environments during binding assays is crucial. Reconstituting CLDN7 in nanodiscs, liposomes, or amphipols before binding studies can preserve structural integrity and functional properties. Controls should include non-binding membrane proteins and claudin mutants with known binding deficiencies .

How can researchers resolve contradictory data regarding bovine CLDN7 function in different experimental systems?

Resolving contradictory data regarding bovine CLDN7 function requires systematic methodological approaches:

  • Standardize experimental conditions:

    • Establish consistent protein preparation protocols (expression system, purification method, quality control metrics)

    • Standardize cell culture conditions (passage number, confluency, culture duration)

    • Use consistent analytical methods with validated sensitivity and specificity

    • Document and control environmental variables (temperature, pH, ionic strength)

  • Address system-specific variables:

    • Expression level effects: CLDN7 function may be concentration-dependent; titrate expression levels

    • Cell type influences: Compare CLDN7 function across multiple relevant cell types

    • Interacting partner availability: Characterize expression of key CLDN7 partners in each system

    • Post-translational modifications: Analyze CLDN7 phosphorylation, palmitoylation status in different systems

  • Resolve contradictions methodically:

    • Direct comparison experiments: Test conflicting findings side-by-side under identical conditions

    • Dependency mapping: Identify conditional factors that determine which function predominates

    • Domain-specific analysis: Use truncation or mutation to isolate functions to specific protein regions

    • Temporal resolution: Examine acute vs. chronic effects of CLDN7 manipulation

  • Validation strategies:

    • Multi-technique confirmation: Verify key findings using independent methodological approaches

    • In vivo correlation: Compare in vitro findings with observations from animal tissues

    • Rescue experiments: Test if contradictory phenotypes can be rescued by controlled CLDN7 re-expression

    • Systems biology approach: Model CLDN7 in network context to identify condition-dependent functions

The most common contradictions in CLDN7 research relate to its role in cancer, where both tumor-suppressive and tumor-promoting functions have been observed. Similar to human CLDN7 studies, bovine CLDN7 may exhibit context-dependent functions that vary with tissue type, pathological state, or experimental conditions. For instance, human CLDN7 shows reduced expression in some colorectal cancer tissues but increased expression in others, suggesting that its functional impact depends on cancer stage, molecular subtype, and microenvironmental factors .

What emerging technologies show promise for studying dynamic changes in bovine CLDN7 localization and function?

Several cutting-edge technologies are revolutionizing the study of dynamic changes in bovine CLDN7 localization and function:

  • Advanced imaging technologies:

    • Super-resolution microscopy (STORM/PALM): Achieves ~20 nm resolution, allowing visualization of individual CLDN7 molecules within tight junction strands

    • Lattice light-sheet microscopy: Enables long-term, low-phototoxicity imaging of CLDN7 dynamics in living cells

    • Correlative light-electron microscopy (CLEM): Combines fluorescence localization with ultrastructural context

    • Expansion microscopy: Physically expands specimens to resolve nanoscale CLDN7 organization

  • Live-cell tracking approaches:

    • CRISPR-based endogenous tagging: Labels native CLDN7 with fluorescent proteins without overexpression artifacts

    • HaloTag/SNAP-tag technologies: Allows pulse-chase imaging of CLDN7 populations over time

    • Optogenetic tools: Controls CLDN7 function with light-activated domains to study acute effects

    • Single-molecule tracking: Measures CLDN7 diffusion dynamics and transition between mobile/immobile states

  • Proximity-based interaction mapping:

    • BioID/TurboID: Identifies proteins in proximity to CLDN7 through biotin labeling

    • APEX2 proximity labeling: Provides temporal resolution of the CLDN7 interactome

    • Split fluorescent protein complementation: Visualizes specific CLDN7 interactions in real-time

  • Multi-omics integration approaches:

    • Spatial transcriptomics: Maps gene expression patterns surrounding CLDN7-high regions

    • Proteomic profiling: Identifies changes in CLDN7 post-translational modifications

    • Single-cell multi-omics: Correlates CLDN7 expression with global cellular state

These technologies are enabling unprecedented insights into the dynamic behavior of CLDN7 in response to physiological stimuli, pathological conditions, and experimental perturbations. For example, super-resolution microscopy has revealed that claudins form dynamic clusters within tight junction strands, with diffusion properties that change during junction assembly and disassembly. By applying these techniques to bovine systems, researchers can better understand the species-specific aspects of CLDN7 function in agricultural and veterinary contexts .

How can CRISPR/Cas9 genome editing be optimized for studying bovine CLDN7 function in primary bovine cell systems?

Optimizing CRISPR/Cas9 genome editing for bovine CLDN7 functional studies requires targeted approaches specific to bovine primary cells:

  • Design considerations for bovine CLDN7 targeting:

    • Select 2-3 guide RNAs targeting early exons (typically exon 1) using bovine-specific design tools

    • Avoid guides with predicted off-target sites in genes related to tight junction function

    • Optimize guide RNA design with enhanced on-target specificity (e.g., high-fidelity Cas9 variants)

    • Consider knock-in strategies for endogenous tagging rather than just knockout approaches

    • Design homology-directed repair templates containing selection markers for enrichment

  • Delivery optimization for bovine primary cells:

    • Nucleofection: Typically achieves 30-60% transfection efficiency in bovine primary cells

    • Lentiviral delivery: Useful for difficult-to-transfect bovine primary cells

    • Ribonucleoprotein (RNP) complexes: Reduces off-target effects and cytotoxicity

    • Optimize delivery timing: Target cells at optimal cell cycle stage for editing efficiency

  • Validation and characterization strategies:

    • Genomic verification: PCR amplification and sequencing of target region

    • Functional validation: Measure transepithelial/transendothelial resistance (TEER) and paracellular flux

    • Protein analysis: Confirm CLDN7 knockout at protein level via Western blot and immunofluorescence

    • Off-target analysis: Whole-genome sequencing or targeted sequencing of predicted off-target sites

    • Phenotypic characterization: Assess growth, morphology, and barrier function

  • Advanced applications:

    • Generate conditional (inducible) CLDN7 knockout using Cre-loxP or similar systems

    • Create precise point mutations to study specific phosphorylation sites or protein-protein interaction domains

    • Implement CRISPR interference (CRISPRi) or activation (CRISPRa) for temporary modulation of CLDN7 expression

    • Develop CRISPR screens to identify genes that modify CLDN7-dependent phenotypes

Table 4: Optimization Parameters for CRISPR/Cas9 Editing of CLDN7 in Bovine Cells

ParameterRecommended SettingRationale
Guide RNA Length20 nucleotidesOptimal balance of specificity and efficiency
PAM SelectionNGG sites within first 100bp of coding sequenceEarly frameshift mutations ensure complete loss of function
Cas9 VariantHigh-fidelity variants (e.g., eSpCas9, SpCas9-HF1)Reduces off-target effects
Delivery MethodNucleofection for epithelial cells; lentiviral for difficult cellsTailored to cell type characteristics
Cell Cycle StageSynchronize in G2/M if possibleEnhances homology-directed repair efficiency
Clone SelectionDilution cloning + functional screeningEnsures homogeneity of edited population

Studies in mouse models have demonstrated successful generation of intestinal conditional knockout models of claudin-7 using Cre-LoxP systems, providing valuable insights that can be adapted to bovine systems for studying CLDN7's role in intestinal barrier function and disease .

What computational models can be applied to predict bovine CLDN7 structural changes during tight junction assembly?

Computational models for predicting bovine CLDN7 structural dynamics during tight junction assembly encompass multiple scales and methodological approaches:

  • Molecular-scale structural modeling:

    • Homology modeling: Generate bovine CLDN7 3D structure based on crystal structures of related claudins

    • Molecular dynamics simulations: Predict conformational changes in CLDN7 during membrane insertion and protein-protein interactions

    • Coarse-grained simulations: Model larger assemblies of multiple CLDN7 molecules in membrane environments

    • Protein-protein docking: Predict interaction interfaces between CLDN7 and binding partners like ZO-1 or other claudins

  • Mesoscale junction assembly models:

    • Agent-based models: Simulate individual CLDN7 molecules as autonomous agents that follow interaction rules

    • Reaction-diffusion models: Capture spatiotemporal dynamics of CLDN7 clustering and strand formation

    • Vertex models: Represent epithelial cell junctions as networks with mechanical properties

    • Phase separation models: Simulate CLDN7 condensation into tight junction domains

  • Tissue-scale barrier function predictions:

    • Compartmental models: Predict paracellular permeability based on CLDN7 distribution patterns

    • Finite element models: Simulate mechanical forces on tight junctions during tissue deformation

    • Multi-scale models: Link molecular CLDN7 properties to tissue-level barrier outcomes

    • Machine learning approaches: Predict barrier properties from CLDN7 expression patterns and modifications

  • Integration with experimental data:

    • Bayesian frameworks: Update structural predictions based on experimental observations

    • Molecular fitting to cryo-EM densities: Refine CLDN7 assembly models using structural data

    • Parameter optimization using permeability data: Calibrate models using functional measurements

Current computational models suggest that claudins form dynamic polymers within the membrane through both cis (same cell) and trans (opposing cell) interactions. The extracellular loops of CLDN7 are predicted to form beta-sheet structures that interact with complementary regions on claudins in the adjacent cell membrane. These models predict that phosphorylation of specific residues in the cytoplasmic domain can alter CLDN7's conformation and interaction propensity, potentially regulating tight junction assembly and disassembly in response to physiological signals .

How can researchers effectively use recombinant bovine CLDN7 to study its role in mammary gland development and lactation?

Researchers can effectively study bovine CLDN7's role in mammary gland development and lactation through systematic application of recombinant protein approaches:

  • In vitro mammary epithelial models:

    • Establish bovine mammary epithelial cell (bMEC) monolayers on permeable supports

    • Manipulate CLDN7 expression via knockdown/overexpression approaches

    • Supplement with recombinant CLDN7 to assess rescue effects

    • Measure barrier integrity through TEER and paracellular permeability assays

    • Evaluate polarized secretion of milk components (caseins, lactose) with and without CLDN7 manipulation

  • 3D organoid culture systems:

    • Generate bovine mammary organoids from primary tissue

    • Compare organoid formation, polarization, and lumen development with varying CLDN7 levels

    • Assess milk protein expression and secretion patterns via immunofluorescence and ELISA

    • Examine the effect of CLDN7 on organoid response to lactogenic hormones

  • Developmental timing studies:

    • Track CLDN7 expression changes during different mammary gland developmental stages

    • Compare virgin, pregnant, lactating, and involuting tissue expression patterns

    • Correlate CLDN7 levels with functional outcomes (milk production, composition)

    • Assess how CLDN7 modifications affect developmental transitions

  • Mechanistic investigations:

    • Examine CLDN7 interactions with other tight junction proteins during lactation

    • Study hormone-induced changes in CLDN7 phosphorylation status

    • Analyze CLDN7's role in maintaining milk-blood barrier integrity

    • Investigate CLDN7's influence on milk composition and quality

Recombinant bovine CLDN7 can be particularly valuable in rescue experiments, where endogenous CLDN7 is depleted and then restored with either wild-type or mutated recombinant protein to identify critical functional domains. Researchers should consider that CLDN7 in mammary tissue may interact with tissue-specific partners not present in other epithelial systems, potentially conferring unique functions relevant to lactation and mammary gland biology .

What are the best approaches for studying the regulation of bovine CLDN7 expression in response to pathogenic challenges?

Studying the regulation of bovine CLDN7 expression during pathogenic challenges requires integrated experimental approaches:

  • In vitro infection models:

    • Challenge bovine epithelial cell monolayers with relevant pathogens (bacteria, viruses, parasites)

    • Monitor real-time changes in CLDN7 expression using reporter constructs

    • Assess transcriptional, post-transcriptional, and post-translational regulation

    • Experimental readouts should include:

      • qRT-PCR for mRNA levels

      • Western blotting for protein levels

      • Immunofluorescence for subcellular localization changes

      • Chromatin immunoprecipitation (ChIP) for promoter binding events

  • Promoter analysis strategies:

    • Clone the bovine CLDN7 promoter region into reporter constructs

    • Identify pathogen-responsive elements through deletion/mutation analysis

    • Perform electrophoretic mobility shift assays (EMSA) to detect transcription factor binding

    • Use ChIP-seq to map genome-wide binding patterns of relevant transcription factors (NF-κB, STAT1/3, AP-1)

  • Post-transcriptional regulation studies:

    • Investigate microRNA-mediated regulation using luciferase reporter assays

    • Assess mRNA stability changes during infection via actinomycin D chase experiments

    • Analyze polysome profiles to detect translational regulation

    • Examine RNA-binding protein interactions with CLDN7 mRNA

  • Signaling pathway delineation:

    • Use pathway-specific inhibitors to identify signaling cascades controlling CLDN7 expression

    • Implement phosphoproteomic analysis to map kinase activation patterns

    • Employ CRISPR screens to identify novel regulatory factors

    • Create a temporal map of signaling events preceding CLDN7 expression changes

Table 5: Pathogen-Specific Effects on CLDN7 Regulation

Pathogen TypeObserved Effect on CLDN7Proposed MechanismExperimental Approach
Gram-negative bacteriaInitial downregulation, later upregulationTLR4-mediated NF-κB activationLPS challenge with signaling inhibitors
Viral pathogensBiphasic regulationInterferon-dependent early response; virus-specific late effectsTime-course analysis with IFN pathway blockade
Parasitic infectionsGradual downregulationSTAT6-dependent mechanism via IL-4/IL-13IL-4/IL-13 stimulation with STAT6 inhibition
Fungal pathogensVariable, strain-dependentDectin-1 signaling pathwayβ-glucan stimulation with pathway inhibitors

Research on intestinal inflammation models suggests that claudin-7 expression is dynamically regulated during inflammatory challenges, with initial downregulation potentially contributing to barrier dysfunction followed by compensatory upregulation during the recovery phase. Similar patterns may be observed in bovine systems challenged with pathogenic stimuli .

How do post-translational modifications of bovine CLDN7 affect its function in different tissue contexts?

Post-translational modifications (PTMs) of bovine CLDN7 significantly influence its function in a tissue-specific manner through multiple mechanisms:

  • Phosphorylation:

    • Sites: Primary phosphorylation occurs on serine/threonine residues in the C-terminal domain

    • Kinases involved: PKA, PKC, WNK4, and CK2 have been identified as claudin kinases

    • Functional effects:

      • Modulates protein-protein interactions with scaffold proteins (ZO-1, ZO-2)

      • Regulates CLDN7 incorporation into tight junction strands

      • Controls half-life through ubiquitination-dependent degradation

      • Tissue-specific effects: In intestinal epithelia, phosphorylation may decrease barrier function, while in renal epithelia, it may enhance ion selectivity

  • Palmitoylation:

    • Sites: Conserved cysteine residues in the transmembrane domains

    • Enzymes: DHHC-family palmitoyl transferases

    • Functional effects:

      • Essential for CLDN7 targeting to glycolipid-enriched membrane microdomains

      • Facilitates interaction with EpCAM outside of tight junctions

      • Stabilizes protein by preventing lysosomal degradation

      • Critical for lateral membrane localization in addition to tight junction incorporation

  • Ubiquitination:

    • Sites: Lysine residues in cytoplasmic domains

    • Enzymes: LNX1 and other E3 ubiquitin ligases

    • Functional effects:

      • Targets CLDN7 for endocytosis and lysosomal degradation

      • Regulates protein turnover during junction remodeling

      • Response mechanism during pathogenic challenges

  • SUMOylation:

    • Sites: Predicted but not fully characterized in bovine CLDN7

    • Functional effects:

      • May regulate nuclear localization of CLDN7 fragments

      • Potential role in stress responses

For systematic analysis of these modifications, researchers should:

  • Generate site-specific mutants (phospho-mimetic and phospho-deficient)

  • Use mass spectrometry-based proteomics to map PTM patterns in different tissues

  • Employ tissue-specific expression of modified CLDN7 variants

  • Correlate PTM status with functional outcomes (barrier properties, protein interactions)

Research indicates that palmitoylation of claudin-7 is particularly important for its unique functions outside of tight junctions. Palmitoylated claudin-7 recruits EpCAM to glycolipid-enriched membrane domains, facilitating a complex that may influence epithelial-mesenchymal transition processes. This modification appears crucial for claudin-7's role in cell-cell adhesion beyond its classical tight junction functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.