Recombinant Bovine Coiled-coil domain-containing protein 107 (CCDC107)

Shipped with Ice Packs
In Stock

Description

Overview of CCDC107

CCDC107, or Coiled-Coil Domain Containing 107, is a protein-coding gene that exists in various organisms, including humans, rats, and mice . It is implicated in diseases such as anauxetic dysplasia 1 and cartilage-hair hypoplasia . Research indicates that the expression of CCDC107 can be influenced by various chemical compounds . Due to the limited research on CCDC107, it is considered a poorly understood target with no known drug or small molecule activities .

Gene-Chemical Interactions

CCDC107 expression is affected by several compounds. The following table summarizes the interactions of CCDC107 with different chemicals in rats :

Chemical CompoundEffect on Expression
(+)-catechinDecreased
(1->4)-beta-D-glucanIncreased
1,2-dimethylhydrazineIncreased
1,3-dinitrobenzeneIncreased
2,3,7,8-tetrachlorodibenzodioxineVaries
2,3,7,8-tetrachlorodibenzofuranIncreased
2-hydroxypropanoic acidDecreased
3-isobutyl-1-methyl-7H-xanthineIncreased
4,4'-sulfonyldiphenolIncreased
CisplatinDecreased
ClofibrateIncreased
Copper(II) sulfateAffected
DexamethasoneIncreased
InulinIncreased
L-methionineIncreased
NefazodoneDecreased
NimesulideDecreased
NitratesIncreased
ParacetamolAffected
Perfluorononanoic acidDecreased
Perfluorooctane-1-sulfonic acidIncreased

Recombinant CCDC107 Protein

Recombinant CCDC107 protein is produced using genetic engineering techniques, often expressed in E. coli . For example, Creative BioMart offers a recombinant full-length bovine CCDC107 protein with a His-tag, expressed in E. coli . This recombinant protein can be used in various research applications.

Expression and Purification

The recombinant form of proteins like CCDC107 is often expressed in E. coli to facilitate research . After expression, the protein is purified for use in experiments. For instance, the recombinant CRM197 protein, structurally and immunologically similar to its C7 counterpart, can be used as a carrier protein in conjugate vaccine development .

Functional Studies

Functional characterization is essential to understand the role of CCDC107. Studies involving protein variants, such as those observed in protein C, help elucidate the functional significance of specific residues . These studies often involve in vitro and cellular assays to assess anticoagulant and anti-inflammatory properties .

CCDC107 ELISA Kit

ELISA (Enzyme-Linked Immunosorbent Assay) kits are available for quantifying CCDC107 in bovine samples . These kits are designed for research purposes to measure the levels of CCDC107 in biological samples .

Relevance to Vaccine Development

The study of recombinant proteins like CCDC107 is significant in vaccine development . Recombinant proteins can serve as carrier proteins in conjugate vaccines, enhancing the immunogenicity of polysaccharides .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CCDC107; Coiled-coil domain-containing protein 107
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-258
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
CCDC107
Target Protein Sequence
DRRSPDRRAHPGDAGQVGPAAAEPRRQSPPSKNQRERARSGALPLGALYTAAAVAFVLYK CLQQGKDEAAVLQEEADKKDSLQSEQHLAQLTQQLVQTEQHLNSLMAQLDPLFERVTTLA GAQQELLHMKLQTIHQLLQDSKPNKGVEVPEPEASIPFLEDFCIEEDEEEAGDNQAWEEP LNWNTGTRNLTPPREMQPTLRRRCRKSAAQGLSHSPHWKEGKTVDGLVKQSLFL
Uniprot No.

Target Background

Database Links

KEGG: bta:514786

UniGene: Bt.53868

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How should researchers optimize storage conditions for recombinant CCDC107 to maintain functional integrity?

Optimal storage of recombinant CCDC107 requires maintaining protein stability while preventing degradation. Storage recommendations include:

  • Primary storage at -20°C in a Tris-based buffer with 50% glycerol

  • For extended preservation, use -80°C storage

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein structure

  • For ongoing experiments, working aliquots can be maintained at 4°C for up to one week

  • Consider adding protease inhibitors if degradation is observed during functional assays

These conditions are optimized for this specific protein, as coiled-coil domains can be particularly susceptible to aggregation when improperly stored.

What expression systems are most effective for producing functional recombinant Bovine CCDC107?

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effectiveMay lack PTMs, potential inclusion bodiesStructure studies, antibody production
Mammalian cellsNative folding, PTMs preservedLower yield, higher costFunctional assays, protein-protein interactions
Insect cellsGood compromise of yield and PTMsMedium complexity, time-consumingComplex domain proteins requiring PTMs

When expressing CCDC107, induction conditions of 0.5-1mM IPTG at 18-20°C overnight often reduces inclusion body formation common with coiled-coil domain proteins. A dual-tag approach (His-tag combined with another solubility tag like MBP) can improve both purification efficiency and protein solubility .

What purification strategy yields the highest purity and activity of recombinant CCDC107?

A multi-step purification protocol is recommended:

  • Initial capture using affinity chromatography (Ni-NTA for His-tagged protein)

  • Intermediate purification via ion exchange chromatography

  • Polishing step using size exclusion chromatography

For optimal results, maintain buffering conditions at pH 7.5-8.0 and include 150-300mM NaCl to prevent protein aggregation. The addition of reducing agents (1-5mM DTT or 0.5-2mM TCEP) helps maintain disulfide bonds in their proper state. Researchers should verify final protein quality through SDS-PAGE, Western blotting, and mass spectrometry prior to functional assays .

What experimental approaches can determine the cellular localization and trafficking of CCDC107?

To elucidate the subcellular distribution of CCDC107:

  • Immunofluorescence microscopy: Transfect bovine cell lines with CCDC107-GFP fusion constructs and co-stain with markers for cellular compartments (ER, Golgi, mitochondria)

  • Subcellular fractionation: Separate cellular components via ultracentrifugation and detect CCDC107 in different fractions using Western blotting

  • Live cell imaging: For dynamic trafficking studies, use photoactivatable fluorescent tags to track protein movement in real-time

Based on similar coiled-coil domain proteins studied in bovine tissues, CCDC107 may associate with cytoskeletal elements or function in membrane organization. Quantitative co-localization analysis with structural markers can reveal functional associations not apparent from sequence data alone .

How can researchers assess protein-protein interactions involving CCDC107?

Several complementary approaches should be employed:

  • Co-immunoprecipitation (Co-IP): Pull down CCDC107 from bovine cell lysates and identify binding partners via mass spectrometry

  • Yeast two-hybrid screening: Identify novel interacting proteins using CCDC107 as bait

  • Proximity labeling techniques: BioID or APEX2 fusion proteins can identify proximal interactors in living cells

  • Surface plasmon resonance (SPR): Determine binding kinetics and affinity for identified interactions

When designing these experiments, consider that coiled-coil domains typically mediate specific protein-protein interactions, often forming homo- or hetero-oligomeric complexes. Controls should include truncated versions lacking the coiled-coil domains to verify domain-specific interactions .

How does CCDC107 expression vary across bovine tissues and developmental stages?

While specific CCDC107 expression data is limited, research approaches should include:

  • Tissue microarrays: Quantitative immunohistochemistry across multiple bovine tissues

  • qRT-PCR analysis: Expression profiling in various tissues and developmental timepoints, using primers:

    • Forward: 5'-TCTGAAGCTGAGCTCCAA-3'

    • Reverse: 5'-AAATTGGTCAAACGGATCCA-3'

  • Single-cell RNA sequencing: To identify cell type-specific expression patterns

Similar to other coiled-coil domain proteins in bovine models, CCDC107 may show tissue-specific expression patterns correlated with specialized cellular structures or functions. Researchers should normalize expression data to multiple reference genes such as GAPDH and β-actin to ensure accurate quantification .

What regulatory mechanisms control CCDC107 expression in bovine cells?

To investigate transcriptional and post-transcriptional regulation:

  • Promoter analysis: Bioinformatic identification of transcription factor binding sites and experimental validation via reporter assays

  • Epigenetic regulation: Assess methylation status of the CCDC107 promoter region and histone modifications via ChIP-seq

  • miRNA targeting: Identify potential miRNA binding sites in the 3'UTR and validate using luciferase reporter assays

  • Post-translational modifications: Phosphorylation, acetylation, or ubiquitination sites that may influence protein stability or function

Studies of related proteins suggest potential regulation via cell cycle-dependent kinases or tissue-specific transcription factors, which should be experimentally validated for CCDC107 .

How should researchers design CRISPR/Cas9 knockout or knockdown experiments for CCDC107 functional studies?

Effective gene editing strategies for CCDC107 require:

  • gRNA design: Multiple gRNAs targeting exons 1-3 of the CCDC107 gene, predicted using algorithms that minimize off-target effects

  • Verification methods:

    • Genomic PCR and sequencing to confirm edits

    • Western blotting to verify protein depletion

    • RT-qPCR to assess mRNA levels

  • Functional rescue experiments: Re-expression of wild-type CCDC107 to confirm phenotype specificity

For temporal control, inducible knockdown systems may better reveal acute versus chronic effects of CCDC107 depletion. Based on studies of related proteins, CCDC107 knockout might affect cellular processes like proliferation or differentiation, which should be assessed using appropriate assays .

What are the optimal conditions for analyzing CCDC107's potential role in bovine cellular differentiation?

When investigating CCDC107's involvement in differentiation processes:

  • Cell model selection: Consider using bovine intramuscular preadipocytes (BIMP) or bovine satellite cells that undergo well-characterized differentiation

  • Temporal analysis: Track CCDC107 expression through a differentiation time course using both mRNA and protein quantification

  • Gain/loss-of-function effects: Overexpress or knockdown CCDC107 at specific differentiation stages to determine temporal requirements

  • Downstream marker analysis: Quantify expression of differentiation markers such as PPARγ, C/EBPα, and tissue-specific transcription factors following CCDC107 manipulation

Research on related proteins suggests monitoring cell cycle regulators (Cyclin D1, Cyclin B1) alongside differentiation markers, as many coiled-coil domain proteins have dual roles in proliferation and differentiation. Oil Red O staining can assess adipogenic differentiation potential, while myogenic markers like MyoD and myogenin should be monitored for muscle differentiation .

How can researchers address solubility and aggregation issues when working with recombinant CCDC107?

CCDC107's coiled-coil domains can present challenges for protein stability. Implement these solutions:

  • Buffer optimization: Screen multiple buffer conditions varying:

    • pH (6.5-8.5)

    • Salt concentration (100-500mM NaCl)

    • Additives (5-10% glycerol, 0.1-0.5% non-ionic detergents)

  • Fusion partners: Consider solubility-enhancing tags such as MBP, SUMO, or Thioredoxin

  • Expression temperature: Reduce to 16-18°C to slow folding and improve proper domain organization

  • Protein quality assessment: Dynamic light scattering (DLS) can detect early aggregation before it becomes visible

  • Storage recommendations: Maintain in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

A systematic approach to troubleshooting using design of experiments (DOE) methodology can efficiently identify optimal conditions for maintaining CCDC107 stability.

What are common pitfalls in analyzing CCDC107 interactions with potential binding partners?

Researchers frequently encounter these challenges when studying CCDC107 interactions:

  • Non-specific binding: Use stringent controls including:

    • Unrelated proteins with similar biochemical properties

    • Versions of CCDC107 with mutated interaction domains

    • Competitive binding assays with synthetic peptides

  • Buffer incompatibility: Interaction buffers may differ from optimal storage conditions; perform buffer screening to find conditions supporting both protein stability and physiologically relevant interactions

  • Transient interactions: Consider crosslinking approaches or proximity labeling for weakly interacting partners

  • Binding environment specificity: Some interactions may require specific cellular contexts (membrane association, pH, or lipid composition)

For proteins like CCDC107 with coiled-coil domains, interactions can be highly conformation-dependent. Always validate in vitro interactions with cellular assays such as FRET, BiFC, or co-localization studies .

How does bovine CCDC107 compare structurally and functionally to homologs in other species?

Comparative analysis provides insight into conserved functions:

SpeciesSequence IdentityKey Structural DifferencesFunctional Implications
Human~85-90% (predicted)Minor variations in C-terminal regionLikely conserved core function
Mouse~80-85% (predicted)Variations in coiled-coil spacingPotential species-specific interactions
Rat~80% (predicted)Similar to mouse variationsSimilar to mouse implications
Zebrafish~60% (predicted)More divergent C-terminusPossible developmental role differences

Phylogenetic analysis suggests CCDC107 evolved under purifying selection, indicating functional importance. The highest conservation typically occurs in the coiled-coil domains, supporting their functional significance. Cross-species functional complementation experiments can test functional conservation hypotheses .

What bioinformatic approaches can predict CCDC107 function based on sequence and structural features?

Multiple computational strategies should be employed:

  • Protein domain prediction: Tools like SMART, Pfam, and COILS for coiled-coil domain identification and characterization

  • Structural modeling: AlphaFold2 or I-TASSER for tertiary structure prediction, especially focused on coiled-coil domain arrangements

  • Protein-protein interaction prediction: Resources such as STRING or BioGRID to identify potential interactors based on co-expression or structural similarity

  • Subcellular localization prediction: Tools like DeepLoc or PSORT to predict cellular compartmentalization

  • Post-translational modification sites: NetPhos, UbPred, or other PTM prediction algorithms to identify regulatory sites

Integrating these predictions with experimental validation has proven effective for characterizing novel coiled-coil domain proteins in other systems .

What are promising applications of CCDC107 research in bovine developmental biology?

Several research avenues warrant investigation:

  • Embryonic development: Examining CCDC107 expression and function during early bovine embryogenesis using in vitro fertilized embryos

  • Tissue differentiation: Investigating potential roles in muscle, adipose, or other tissue development, particularly in economically important traits like marbling in beef cattle

  • Cell division regulation: Exploring potential functions in cytoskeletal organization during mitosis, similar to other coiled-coil domain proteins

  • Transgenic models: Developing CCDC107 knockout or reporter cattle to track expression and function in vivo

Research on related proteins suggests CCDC107 may influence cellular processes like proliferation and differentiation, which are critical for tissue development. Studies focusing on cell type-specific expression patterns during different developmental stages could reveal novel functions .

How might CCDC107 research inform understanding of cellular differentiation mechanisms in bovine tissues?

Building on research with related proteins:

  • Adipogenic differentiation: Given findings with CDC10/Septin 7, investigate CCDC107's potential role in bovine adipogenesis, particularly in intramuscular fat development

  • Signaling pathway integration: Examine interactions with known differentiation regulators such as PPARγ and C/EBPα pathways

  • Cell cycle exit coordination: Study potential roles in the transition from proliferation to differentiation phases

  • Cytoskeletal reorganization: Investigate functions in the structural changes accompanying cellular differentiation

Methodological approaches should include:

  • Temporal expression profiling during differentiation

  • Gain and loss-of-function studies at specific differentiation stages

  • Identification of binding partners specific to differentiating cells

  • Assessment of effects on lineage-specific transcription factors

Research on CDC10/Septin 7 has shown that similar proteins can promote adipocyte differentiation through mechanisms affecting expression of adipogenic marker genes, suggesting CCDC107 may have comparable functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.