Recombinant Bovine Coiled-coil domain-containing protein 51 (CCDC51)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CCDC51; Mitok; Mitochondrial potassium channel; MITOK; Coiled-coil domain-containing protein 51
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-404
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
CCDC51
Target Protein Sequence
MTGRSRVLAMRHVGGVSPVLVRRDLFLTRTLCSHGPSQPREKRPEEVALGLYHRLTALGA ALGHSIRQRASSTAKTWWDRYEEFVGLNEVREAQGNVTEAEKVFMVARGLVREAREDLES QQTKLKEVRDRLDRISRDDNQYLELATLEHRMLQEEKRLRMTYLRAEDSEREKFSLFSAA VRESHEKERTRAERTKNWSLIGSVLGALIGVAGSTYVNRVRLQELKALLLEAQKGPVSLQ EAIREQASSYSLQQRDLRDLVADLKGLVQAGTGQGSLSQAGSSPTQDRDTDVLSAALREQ LSHSRQVRSRLEGLREQLDGLEKTVSQVAGVVQLAKAAAHPGLESADGALPGSLLEQGSM IMALSDTEQRLEAQVNRNTVYGTLVTCATFVAVLPVLYMLFRAS
Uniprot No.

Target Background

Function
Recombinant Bovine Coiled-coil domain-containing protein 51 (CCDC51) is a mitochondrial potassium channel residing in the inner mitochondrial membrane. In conjunction with ABCB8/MITOSUR, it forms a mitochondrial protein complex mediating ATP-dependent potassium currents across the inner membrane (the mitoK(ATP) channel). It may regulate cellular metabolism under stress by controlling mitochondrial matrix volume.
Database Links

KEGG: bta:517515

UniGene: Bt.10951

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of CCDC51 and how is it evolutionarily conserved?

CCDC51 is a 411 amino acid protein with a calculated molecular weight of 46 kDa. The protein contains an N-terminal mitochondrial targeting sequence (MTS) and two transmembrane domain segments interspersed with coiled-coil domains . CCDC51's structure includes coiled-coil domains that face both the mitochondrial matrix and the intermembrane space (IMS), which are critical for its proper function .

Recent bioinformatic analyses have identified CCDC51 as a structural ortholog of the yeast protein Mdm33, despite previous beliefs that Mdm33 lacked a mammalian homolog . Both proteins share similar domain architecture with N-terminal MTS, transmembrane segments, and coiled-coil domains, suggesting functional conservation across species . This evolutionary conservation indicates the fundamental importance of this protein in mitochondrial biology.

What is the subcellular localization of CCDC51 and how does it relate to its function?

CCDC51 is an inner mitochondrial membrane protein with a specific orientation where its coiled-coil domains face both the mitochondrial matrix and the intermembrane space . This localization is essential for its role in mitochondrial fission processes. When visualized through immunofluorescence techniques, CCDC51 shows a distribution pattern throughout the mitochondrial network but can also concentrate at discrete foci that often mark sites of future mitochondrial fission events .

Mutation studies have demonstrated that the transmembrane domain 1 (TM1) and the IMS coiled-coil domain are particularly important for proper localization and function of CCDC51 . When these domains are compromised, CCDC51 fails to distribute normally within mitochondria and consequently cannot maintain proper mitochondrial morphology or promote efficient fission.

How does CCDC51 depletion affect mitochondrial morphology?

Depletion of CCDC51, either through siRNA knockdown or CRISPR interference, leads to distinctive morphological abnormalities in mitochondria. These include the formation of extensive rings and sheet-like lamellar structures . This phenotype remarkably resembles the mitochondrial morphology defects observed in yeast cells lacking Mdm33, further supporting their functional conservation .

Quantitative analysis shows that CCDC51-depleted cells exhibit significantly reduced rates of mitochondrial fission (approximately 32% less frequent compared to control cells) . This reduction in fission events contributes directly to the abnormal mitochondrial morphology. Importantly, while CCDC51 depletion reduces fission frequency, it does not completely abolish fission events, suggesting CCDC51 mediates a subset of fission processes rather than being universally required for all fission events .

What antibodies and detection methods are most effective for studying CCDC51 in bovine and other mammalian systems?

For detecting CCDC51 in experimental systems, polyclonal antibodies have shown high specificity and versatility across multiple applications. According to validation data, the 20465-1-AP antibody has been effectively used in Western Blot (WB), Immunohistochemistry (IHC), and Immunofluorescence/Immunocytochemistry (IF/ICC) applications with demonstrated reactivity in human, mouse, and rat samples .

Recommended antibody dilutions for various applications:

ApplicationRecommended Dilution
Western Blot (WB)1:2000-1:10000
Immunohistochemistry (IHC)1:50-1:500
Immunofluorescence (IF)/ICC1:50-1:500

For IHC applications, optimal antigen retrieval protocols involve using TE buffer at pH 9.0, though citrate buffer at pH 6.0 may be used as an alternative . When working with bovine samples specifically, cross-reactivity testing is advisable as most commercial antibodies are validated against human, mouse, and rat samples.

What are the most effective methods for CCDC51 knockdown or knockout in experimental systems?

Both transient knockdown and stable depletion methods have been successfully used to study CCDC51 function. siRNA-mediated knockdown provides acute depletion and is useful for examining immediate effects on mitochondrial dynamics, while CRISPR interference (CRISPRi) systems allow for longer-term studies of CCDC51 depletion effects .

In published studies, both approaches have successfully reduced CCDC51 expression and produced consistent phenotypes, including abnormal mitochondrial morphology and reduced fission rates . The CRISPRi approach may be preferable for long-term studies as it avoids potential transient effects and allows for rescue experiments using exogenously expressed CCDC51 variants.

For functional studies, domain-specific mutant constructs have been particularly informative. Specifically, deletions of the matrix coiled-coil (∆matrix CC) or IMS coiled-coil (∆IMS CC) domains have revealed their differential contributions to CCDC51 function and localization .

How can researchers effectively visualize and quantify CCDC51-mediated mitochondrial fission events?

Live-cell imaging approaches combining mitochondrial staining with fluorescently tagged CCDC51 provide the most comprehensive data on fission dynamics. MitoTracker staining of cells combined with time-lapse microscopy has been successfully used to quantify mitochondrial fission rates in both control and CCDC51-depleted cells .

For simultaneous visualization of mtDNA and fission events, co-staining with MitoTracker and the mtDNA dye PicoGreen allows researchers to examine the relationship between mtDNA positioning and fission site selection . This approach has revealed that while mtDNA is associated with a majority of fission events, this association is maintained even in CCDC51-depleted cells.

Quantification methodology typically involves:

  • Counting the number of fission events per cell over a defined time period

  • Normalizing to mitochondrial mass or network size

  • Characterizing fission events based on location (e.g., proximity to tubule tips or branch points)

  • Analyzing co-localization with other mitochondrial proteins or structures

How does CCDC51 interact with the mitochondrial fission machinery, and what experimental approaches best capture these interactions?

CCDC51 appears to function as a positive effector of mitochondrial fission through its interaction with the canonical fission machinery. When overexpressed, GFP-CCDC51 accumulates at discrete foci that strongly co-localize with both Drp1 (dynamin-related protein 1) and MFF (mitochondrial fission factor), key components of the mitochondrial fission machinery .

To experimentally study these interactions, co-immunoprecipitation and proximity labeling techniques (BioID or APEX) can be employed. Immunofluorescence co-localization studies have successfully demonstrated that the vast majority of GFP-CCDC51 foci co-localize with Drp1 and MFF foci, indicating that CCDC51 promotes the local recruitment of mitochondrial fission machinery .

Quantitative analysis of co-localization shows that CCDC51 has a significantly higher spatial association with fission machinery components (Drp1, MFF) than with other mitochondrial structures like mtDNA nucleoids:

CCDC51 co-localizationPercentage
With Drp1 fociHigh (>75%)
With MFF fociHigh (>75%)
With mtDNA nucleoidsLow (<25%)

These findings suggest CCDC51 plays a specific role in recruiting or stabilizing the fission machinery rather than generally affecting mitochondrial ultrastructure .

What is the role of CCDC51 as a potential biomarker in cancer research, and how should experimental designs address this application?

Pan-cancer analysis has identified CCDC51 as a potential biomarker for various cancers, particularly liver hepatocellular carcinoma (LIHC) . ROC curve analysis indicates that CCDC51 can function as a biomarker with high sensitivity and specificity (AUC>0.75) for diagnosing several cancer types including breast cancer (BRCA), cervical squamous cell carcinoma (CESC), cholangiocarcinoma (CHOL), and colorectal adenocarcinoma .

For experimental design in cancer biomarker studies, researchers should consider:

  • Multi-cancer tissue analysis: Examining CCDC51 expression across diverse cancer types to establish specificity

  • Correlation with clinical outcomes: Analyzing survival data in relation to CCDC51 expression levels

  • Comparison with established biomarkers: Evaluating CCDC51 performance against currently used clinical biomarkers

  • Integration with immune infiltration data: Assessing relationships between CCDC51 expression and tumor immune microenvironment

While CCDC51 shows promise as a biomarker, current research highlights the need for experimental validation, as "there is no experimental" confirmation of the relationship between CCDC51 and immune infiltration in pan-cancer .

How do the matrix-facing and intermembrane space-facing coiled-coil domains of CCDC51 differentially contribute to its function?

CCDC51 contains distinct coiled-coil domains that face either the mitochondrial matrix or the intermembrane space (IMS). Through domain deletion studies, researchers have established that these domains have differential contributions to CCDC51 function .

The IMS coiled-coil domain appears essential for proper CCDC51 function and localization. When this domain is deleted (∆IMS CC), CCDC51 fails to rescue the mitochondrial morphology defect in CCDC51-depleted cells and instead concentrates in discrete foci, similar to nonfunctional transmembrane domain 1 (TM1) mutants .

In contrast, deletion of the matrix coiled-coil domain (∆matrix CC) produces a different phenotype. While this construct successfully alleviates the lamellar mitochondrial morphology of CCDC51-depleted cells, it frequently induces excessive mitochondrial fragmentation . Additionally, the ∆matrix CC construct distributes uniformly along mitochondria rather than concentrating at discrete foci.

These findings suggest a model where:

  • The IMS coiled-coil domain is critical for proper CCDC51 localization and basic function

  • The matrix coiled-coil domain may play a regulatory role, potentially limiting excessive fission activity

  • The balanced activity of both domains contributes to normal mitochondrial morphology and dynamics

How should researchers interpret discrepancies between CCDC51 expression data and functional outcomes in different experimental systems?

When analyzing CCDC51 data across different experimental systems, researchers should consider several factors that might contribute to apparent discrepancies:

  • Expression level effects: CCDC51 appears to have dose-dependent effects on mitochondrial morphology. While depletion leads to extended lamellar structures and reduced fission, overexpression promotes fragmentation . These opposing phenotypes suggest that CCDC51 function is highly sensitive to expression levels.

  • Cell type differences: Different cell lines may express varying levels of other mitochondrial fission/fusion proteins that interact with CCDC51. This could lead to cell type-specific outcomes when CCDC51 expression is altered.

  • Acute vs. chronic alterations: Acute depletion (siRNA) versus stable depletion (CRISPRi) of CCDC51 produces somewhat different severities of phenotype , suggesting cellular adaptation mechanisms.

  • Species-specific functions: While CCDC51 and Mdm33 are functionally conserved, they may have acquired additional species-specific functions during evolution that could confound cross-species comparisons.

To address these challenges, experimental designs should include:

  • Multiple methods of expression modulation (siRNA, CRISPRi, overexpression)

  • Time-course experiments to distinguish acute from chronic effects

  • Quantitative rather than qualitative assessments of phenotypes

  • Complementation studies across species to determine functional conservation

What are the most promising directions for future research on bovine CCDC51 based on current knowledge?

Based on current knowledge about CCDC51 structure and function, several promising research directions emerge:

  • Comparative studies between bovine and human CCDC51: Investigating potential species-specific functions and regulation could provide insights into mitochondrial evolution and specialized metabolic adaptations in bovine tissues.

  • Mechanistic studies of CCDC51 in mitochondrial fission: Further elucidating how CCDC51 in the inner membrane communicates with the outer membrane fission machinery (Drp1, MFF) to coordinate fission events.

  • CCDC51 post-translational modifications: Identifying regulatory modifications that control CCDC51 activity or localization, particularly in response to cellular stress or metabolic changes.

  • Tissue-specific functions: Exploring potential tissue-specific roles of CCDC51 in tissues with high mitochondrial content such as cardiac and skeletal muscle, particularly in the context of bovine physiology.

  • CCDC51 in mitochondrial disease models: Investigating whether CCDC51 mutations or expression changes contribute to mitochondrial disorders, potentially revealing therapeutic targets.

  • Metabolic regulation: Examining how CCDC51-mediated changes in mitochondrial dynamics affect metabolic processes, especially in bovine tissues with specialized metabolic requirements.

What are common challenges in expressing and purifying recombinant CCDC51, and how can they be addressed?

Expressing and purifying transmembrane proteins like CCDC51 presents several technical challenges. Based on established protocols for similar proteins, researchers should consider:

  • Expression system selection: Mammalian expression systems are often preferable for transmembrane proteins to ensure proper folding and post-translational modifications. HEK293 or CHO cells typically yield better results than bacterial systems for complex mammalian proteins .

  • Solubilization strategies: As a membrane protein, CCDC51 requires careful selection of detergents. A step-wise screening approach testing mild detergents like DDM, LMNG, or digitonin is recommended, as these preserve protein structure better than harsher detergents like SDS.

  • Affinity tag placement: N-terminal tags may interfere with the mitochondrial targeting sequence. C-terminal tags are generally preferable, though they may affect coiled-coil domain interactions.

  • Stability during purification: Addition of lipids during purification can help stabilize membrane proteins. Consider including cardiolipin, a key mitochondrial lipid, in purification buffers.

  • Functional verification: Develop activity assays to confirm that purified CCDC51 maintains its native conformation and function, particularly for its interaction with fission machinery components.

What controls are essential when studying CCDC51 knockdown or overexpression phenotypes?

When designing experiments to study CCDC51 function through expression modulation, several critical controls should be included:

  • Rescue experiments: For knockdown or knockout studies, expressing wild-type CCDC51 should rescue the phenotype, confirming specificity . Domain mutants can provide additional mechanistic insights.

  • Multiple depletion methods: Using both siRNA and CRISPR-based approaches helps distinguish acute from chronic effects and confirms phenotype specificity .

  • Expression level verification: Quantitative western blotting is essential to confirm knockdown efficiency or overexpression levels. Calibration curves with known protein quantities improve accuracy.

  • Mitochondrial integrity controls: Assessments of membrane potential (using TMRE or JC-1), respiratory capacity, and mtDNA maintenance should accompany morphology studies to distinguish primary from secondary effects.

  • Off-target effect controls: For siRNA experiments, using multiple siRNAs targeting different regions of CCDC51 mRNA helps exclude off-target effects. For overexpression, comparing wild-type to functionally deficient mutants controls for non-specific effects of protein accumulation.

  • Temporal controls: Time-course experiments help distinguish immediate effects from adaptive responses in both knockdown and overexpression studies.

How does CCDC51 research integrate with broader studies of mitochondrial dynamics and disease?

CCDC51 research connects to multiple areas of mitochondrial biology and disease, offering several interdisciplinary research opportunities:

  • Mitochondrial dynamics networks: CCDC51 adds complexity to our understanding of mitochondrial fission by revealing inner membrane contributions to a process previously thought to be primarily driven by outer membrane components . This provides an opportunity to reexamine other fission events for potential inner membrane contributions.

  • Neurodegenerative diseases: Given the critical importance of mitochondrial dynamics in neurons and the association of dysregulated fission with neurodegenerative conditions, CCDC51 variants could be explored as risk factors or modifiers in diseases like Parkinson's or Alzheimer's.

  • Cancer metabolism: The identification of CCDC51 as a potential cancer biomarker suggests connections between mitochondrial dynamics and cancer progression. Research could explore how altered CCDC51 expression affects metabolic reprogramming in cancer cells.

  • Cardiovascular physiology: Tissues with high mitochondrial content like heart muscle are particularly dependent on proper mitochondrial dynamics. CCDC51's role in these tissues, especially in bovine models with relevance to cardiac physiology, merits investigation.

  • Aging research: Mitochondrial dynamics change with age, and CCDC51-mediated fission may contribute to age-related mitochondrial fragmentation. Studies examining CCDC51 expression and function across the lifespan could provide insights into mitochondrial aspects of aging.

What computational approaches can enhance our understanding of CCDC51 structure-function relationships?

Computational methods offer powerful tools for exploring CCDC51 biology beyond traditional experimental approaches:

  • Structural prediction: While no crystal structure of CCDC51 exists, AlphaFold or RoseTTAFold can generate reliable predictions of CCDC51's structure, particularly for the soluble coiled-coil domains. These models can guide mutational studies and interaction predictions.

  • Molecular dynamics simulations: For transmembrane proteins like CCDC51, simulations in lipid bilayers can reveal conformational changes and potential mechanisms of action during membrane remodeling events.

  • Network analysis: Integration of proteomic and transcriptomic data can place CCDC51 within broader mitochondrial functional networks, identifying potential indirect effects of CCDC51 modulation on cellular physiology.

  • Evolutionary analysis: Detailed phylogenetic studies across species can identify conserved regions under selective pressure, highlighting functionally critical domains beyond those already characterized.

  • Docking studies: In silico modeling of CCDC51 interactions with known binding partners like components of the fission machinery can generate testable hypotheses about interaction interfaces and regulatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.