Recombinant Bovine Coiled-coil domain-containing protein 56 (CCDC56)

What is the primary structure of Bovine CCDC56?

Bovine CCDC56 is a relatively small protein consisting of 106 amino acids in its mature form (residues 2-106). The protein contains a characteristic coiled-coil domain, which is critical for its function. The full amino acid sequence is: ATPGPGDPVDAKSGKAPLAQRIDPTREKLTPAQLQFMRQAQLAQWQKTLPQRRTRNIVTGLGIGALVLAIYGYTFYSVSQERFLDELEDEAKAARARALERASGH . This sequence information is essential for designing experiments involving recombinant expression, antibody production, or mutational analyses.

What is the cellular localization of CCDC56?

CCDC56 is primarily localized to mitochondria, where it functions as a cytochrome c oxidase assembly factor . Research indicates that the protein is conserved across metazoans, with human and Drosophila versions sharing 42% amino acid identity despite some length differences (106 amino acids in humans versus 87 in flies) . For subcellular localization studies, mitochondrial fractionation protocols are recommended, followed by western blot analysis using CCDC56-specific antibodies.

What is the relationship between CCDC56 and cytochrome c oxidase?

CCDC56 plays a crucial role in the assembly and functionality of cytochrome c oxidase (COX), which is Complex IV of the mitochondrial respiratory chain. Studies in Drosophila have demonstrated that CCDC56 knockout results in significantly decreased levels of fully assembled COX and reduced COX activity, while other oxidative phosphorylation complexes remain unaffected or show increased activity . This relationship suggests CCDC56 is a specific assembly factor for COX biogenesis rather than a general mitochondrial protein.

How should researchers design expression and purification protocols for recombinant CCDC56?

For optimal expression and purification of recombinant CCDC56, the following protocol is recommended:

• Expression system: E. coli has been successfully used to express full-length bovine CCDC56 with an N-terminal His-tag

• Purification method: Affinity chromatography using Ni-NTA columns

• Storage conditions: Store as lyophilized powder or reconstituted in Tris/PBS-based buffer with 6% trehalose at pH 8.0

• For long-term storage: Add glycerol to 5-50% final concentration and store at -20°C/-80°C in aliquots

• Reconstitution: Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

The purity should be greater than 90% as determined by SDS-PAGE analysis. Avoid repeated freeze-thaw cycles as they may affect protein integrity .

What experimental approaches are most effective for studying CCDC56 function in mitochondria?

A comprehensive experimental approach to study CCDC56 function should include:

• Gene knockout/knockdown models:

  • CRISPR-Cas9 gene editing for complete knockout

  • siRNA or shRNA for transient knockdown

  • Inducible systems for controlled expression

• Functional assays:

  • Cytochrome c oxidase activity measurements using spectrophotometric methods

  • Respiratory chain complex assembly analysis via blue native PAGE

  • Mitochondrial respiration using Seahorse XF Analyzer or Clark-type oxygen electrodes

• Interaction studies:

  • Co-immunoprecipitation to identify binding partners

  • Proximity labeling (BioID or APEX) to identify proximal proteins

  • Yeast two-hybrid screening for potential interactors

• Rescue experiments:

  • Reintroduction of wild-type CCDC56 in knockout models

  • Expression of mutant variants to identify critical residues/domains

The use of multiple complementary approaches provides robust evidence for CCDC56 function and mechanisms of action .

How can researchers control for experimental variables when studying CCDC56?

When designing experiments involving CCDC56, researchers should control for the following variables:

Additionally, following established experimental design principles is crucial: define clear hypotheses, include appropriate controls, randomize samples, and perform sufficient biological and technical replicates to ensure statistical validity .

How does CCDC56 contribute to the assembly of cytochrome c oxidase at the molecular level?

At the molecular level, CCDC56 appears to function as a specialized assembly factor for cytochrome c oxidase. Studies in Drosophila have shown that CCDC56 knockout results in:

• Decreased levels of fully assembled COX complexes

• Reduced COX activity

• Normal or increased activity of other respiratory chain complexes

• Developmental arrest at the third larval instar stage

The molecular mechanism likely involves CCDC56 functioning as a chaperone or scaffold during specific steps of COX assembly. Similar to other coiled-coil domain-containing proteins, CCDC56 may facilitate protein-protein interactions through its coiled-coil domain, potentially bringing together subunits or assembly factors during COX biogenesis. Advanced structural biology techniques (cryo-EM, X-ray crystallography) combined with crosslinking mass spectrometry would help elucidate the precise molecular interactions.

What are the implications of the evolutionary conservation of CCDC56 across metazoans?

The high degree of conservation of CCDC56 across metazoans (42% amino acid identity between Drosophila and human proteins) suggests an essential and fundamental role in mitochondrial function . This conservation presents several research implications:

• Model organism applicability: Findings from model organisms like Drosophila are likely relevant to mammalian systems

• Evolutionary pressure: The conserved regions likely represent functionally critical domains

• Therapeutic potential: Conserved proteins often represent potential therapeutic targets for metabolic or mitochondrial disorders

Comparative genomics approaches could identify the most highly conserved residues across species, which would be prime candidates for site-directed mutagenesis studies to determine functional significance.

How might post-translational modifications affect CCDC56 function?

While the search results don't specifically address post-translational modifications (PTMs) of CCDC56, the protein may be subject to regulatory modifications similar to other mitochondrial proteins. Potential PTMs and their functional implications include:

• Phosphorylation: May regulate protein-protein interactions or protein stability

• Ubiquitination: Could control protein turnover (as seen with the related protein CCDC69, which is regulated by CDC20-mediated ubiquitination)

• Acetylation: May influence interaction with other mitochondrial proteins

To investigate PTMs on CCDC56, researchers should consider:

• Immunoprecipitation followed by mass spectrometry analysis

• Phosphorylation-specific antibodies for western blotting

• Ubiquitination assays similar to those used for CCDC69

• Mutational analysis of potential modification sites

What are common challenges in expressing and purifying recombinant CCDC56?

Researchers often encounter several challenges when working with recombinant CCDC56:

• Protein solubility issues: As a mitochondrial protein, CCDC56 may have hydrophobic regions that affect solubility

  • Solution: Optimize buffer conditions; consider detergents or solubilizing agents; use fusion tags

• Degradation during purification: Small proteins can be susceptible to proteolysis

  • Solution: Include protease inhibitors; perform purification at 4°C; minimize time between steps

• Low expression levels: Mitochondrial proteins may not express well in bacterial systems

  • Solution: Test multiple expression systems; optimize codon usage; try inducible promoters

• Proper folding: Ensuring correct folding of the coiled-coil domain

  • Solution: Verify protein structure using circular dichroism; include molecular chaperones during expression

• Maintaining activity: Preserving functional activity after purification

  • Solution: Validate function with activity assays; optimize storage conditions (6% trehalose has been successfully used)

How can researchers address inconsistent results in CCDC56 functional studies?

When facing inconsistent results in CCDC56 functional studies, consider the following methodological solutions:

• Standardize expression verification: Always confirm CCDC56 expression levels by western blot

• Control for mitochondrial integrity: Assess mitochondrial health using JC-1 dye or other integrity markers

• Account for cellular context: CCDC56 function may vary depending on cell type or metabolic state

  • Solution: Use multiple cell types; test under different metabolic conditions

• Improve experimental design:

  • Increase sample size and number of independent experiments

  • Include appropriate controls for each experimental condition

  • Blind analysis to reduce confirmation bias

• Consider genetic background effects:

  • Use isogenic cell lines when comparing wild-type and mutant CCDC56

  • Account for potential compensatory mechanisms in chronic knockdown/knockout models

What are the potential links between CCDC56 dysfunction and human diseases?

Given CCDC56's critical role in cytochrome c oxidase assembly, dysfunction of this protein could potentially contribute to mitochondrial disorders. Future research should explore:

• Screening for CCDC56 mutations in patients with undiagnosed mitochondrial cytochrome c oxidase deficiencies

• Investigating CCDC56 expression levels in tissues from patients with mitochondrial disorders

• Developing mouse models with tissue-specific CCDC56 knockout to characterize physiological effects

• Exploring potential connections between CCDC56 variants and susceptibility to conditions associated with mitochondrial dysfunction, such as neurodegenerative diseases, cardiomyopathies, or metabolic disorders

How might the structure-function relationship of CCDC56 be further elucidated?

To better understand the structure-function relationship of CCDC56, researchers should consider:

• Structural biology approaches:

  • X-ray crystallography or NMR spectroscopy of purified CCDC56

  • Cryo-EM analysis of CCDC56 in complex with interacting partners

  • Molecular dynamics simulations to predict functional domains

• Mutagenesis studies:

  • Systematic alanine scanning of the coiled-coil domain

  • Creation of chimeric proteins with coiled-coil domains from related proteins

  • Site-directed mutagenesis of highly conserved residues across species

• Domain mapping:

  • Generate truncation mutants to identify minimal functional domains

  • Investigate the importance of the coiled-coil domain using approaches similar to those used for TRIM56, where the entire coiled-coil domain was found to be essential for function

• Interaction studies:

  • Identify the complete interactome of CCDC56 during different stages of COX assembly

  • Map binding interfaces using crosslinking mass spectrometry