Recombinant Bovine Coiled-coil domain-containing transmembrane protein C7orf53 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LSMEM1; Leucine-rich single-pass membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
LSMEM1
Target Protein Sequence
MKRSSQDSGSRSIPEDRKLYVVDSINDLNKLNLCPAGSQQLFPLEEKLQDISTDSGNGSR SLFLVGLIIVLIISLALVSFVIFLIVQTENKMEDVSRRLAAEGKDIDDLKKINSIIVKRL NQLDSEQS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is C7orf53 and how is it characterized in bovine systems?

C7orf53 (chromosome 7 open reading frame 53) is a protein-coding gene originally identified in humans (ENSG00000181016) with a bovine homolog that can be studied through comparative genomics approaches . The bovine homolog shares structural features including coiled-coil domains and transmembrane regions.

Characterization typically involves:

  • Genome mining using human C7orf53 as a query sequence against bovine genome databases

  • Identification of expressed sequence tags (ESTs) from bovine tissues

  • Confirmation of open reading frames using transcriptome data

  • Prediction of protein domains using bioinformatics tools like SMART, Pfam, and COILS

Researchers often employ RNA-Seq to identify novel transcripts in bovine tissues, similar to approaches used for detecting unannotated genes in porcine studies . When performing gene expression analysis, designs should limit potential unwanted signal from contaminating genomic DNA, typically by using intron-spanning primers .

What techniques are most effective for studying the tissue expression pattern of bovine C7orf53?

Multiple complementary approaches provide robust expression profiling:

  • RNA-Seq: Provides comprehensive transcriptome-wide analysis and can detect novel transcripts across multiple tissues. This approach has successfully identified previously unannotated genes in livestock species including pigs and cattle .

  • RT-qPCR: Offers targeted, highly sensitive quantification of expression levels. Strong correlations (ranging from 0.79 to 0.96) between RNA-Seq and RT-qPCR platforms have been observed in previous studies, confirming the reproducibility of expression data .

  • Northern blotting: Though less sensitive than PCR-based methods, it provides visualization of transcript size and potential splice variants.

  • In situ hybridization: Permits localization of expression to specific cell types within tissues.

A comparative tissue panel is recommended, including liver, muscle, adipose tissue, and reproductive organs, as these tissues often express novel genes with specialized functions in bovine systems.

How can researchers confirm that a newly identified sequence is truly the bovine homolog of human C7orf53?

Confirmation requires multiple lines of evidence:

  • Sequence homology analysis: BLASTP comparison against known C7orf53 proteins from human and other species. Similar to procedures used in pig transcriptome studies, where predicted novel proteins were compared against human, bovine, and porcine protein databases .

  • Domain architecture comparison: Verify the presence of characteristic features like coiled-coil domains and transmembrane regions using tools such as TMHMM, TMpred, and COILS.

  • Conserved synteny analysis: Examine whether neighboring genes in the bovine genome match those flanking C7orf53 in humans.

  • Phylogenetic analysis: Construct trees to demonstrate evolutionary relationships between the bovine sequence and C7orf53 from other species.

  • Expression profile comparison: Similar tissue-specific expression patterns support homology.

This multi-faceted approach reduces the risk of misidentifying paralogs or related family members as the true ortholog.

What are the predicted structural features of bovine C7orf53 and how can they be experimentally validated?

Predicted features typically include:

  • Coiled-coil domains (predicted by COILS, Paircoil, or MultiCoil)

  • Transmembrane segments (predicted by TMHMM, TMpred)

  • Signal peptides (predicted by SignalP)

  • Post-translational modification sites

Experimental validation strategies include:

  • Topology mapping: Using epitope insertion followed by selective permeabilization immunofluorescence or protease protection assays.

  • Deletion mutant analysis: Systematic removal of predicted domains to assess impact on localization and function.

  • Fusion protein approaches: Attaching reporter proteins to different segments to confirm membrane orientation.

  • Circular dichroism spectroscopy: To confirm secondary structure predictions, particularly alpha-helical content typical of coiled-coil domains.

  • Limited proteolysis: To identify domain boundaries and solvent-exposed regions.

These approaches systematically test computational predictions against experimental evidence.

What expression systems are optimal for producing recombinant bovine C7orf53?

The choice of expression system depends on experimental goals:

Expression SystemAdvantagesDisadvantagesRecommendations for C7orf53
E. coliHigh yield, low cost, rapidLimited post-translational modifications, inclusion body formation common with transmembrane proteinsConsider fusion tags (MBP, SUMO); use specialized strains (C41/C43); solubilize with mild detergents
Insect cellsBetter folding of complex proteins, moderate yieldHigher cost, slower than bacterial systemsBaculovirus expression system works well for many transmembrane proteins
Mammalian cellsNative post-translational modifications, proper foldingHighest cost, lowest yieldHEK293 or CHO cells recommended for functional studies
Cell-free systemsAvoids toxicity issues, rapidLimited scale, expensiveConsider for initial screening of constructs

For structural studies requiring milligram quantities, a dual approach is recommended: initial screening in E. coli with various solubility tags, followed by scale-up in insect cells for constructs showing promise. For functional studies, mammalian expression (particularly bovine cell lines when available) provides the most physiologically relevant context.

How can researchers address the challenges of purifying recombinant transmembrane proteins like C7orf53?

Purification of transmembrane proteins presents unique challenges:

  • Optimized solubilization: Systematic screening of detergents (DDM, LMNG, GDN) and lipid-like materials (amphipols, nanodiscs) to maintain native structure.

  • Truncation strategies: Identifying minimal functional domains through limited proteolysis and expression of soluble fragments.

  • Fusion partners: Strategic placement of purification tags to avoid interfering with transmembrane domains.

  • Two-phase purification protocol:

    • Initial IMAC (immobilized metal affinity chromatography) under denaturing conditions

    • Gradual refolding through detergent exchange

    • Secondary purification step (size exclusion chromatography)

  • Stability assessment: Using fluorescence-based thermal shift assays to identify optimal buffer conditions.

This systematic approach increases the likelihood of obtaining pure, properly folded protein for downstream analyses.

What methods are most effective for determining the subcellular localization of bovine C7orf53?

Multiple complementary approaches are recommended:

  • Fluorescent protein fusions: C- and N-terminal GFP fusions expressed in bovine cell lines, with quantitative colocalization analysis against organelle markers.

  • Immunofluorescence microscopy: Using antibodies against the native protein or epitope tags, combined with super-resolution techniques for detailed localization.

  • Subcellular fractionation: Differential centrifugation followed by Western blotting to determine enrichment in specific cellular compartments.

  • Proximity labeling approaches: BioID or APEX2 fusions to identify neighboring proteins in cellular compartments.

  • Electron microscopy: Immunogold labeling for high-resolution localization studies.

A multi-method consensus approach is strongly recommended, as each technique has inherent limitations. Particular attention should be paid to potential artifacts from overexpression or tag interference with trafficking signals.

How can functional genomics approaches be applied to understand the role of bovine C7orf53?

Functional genomics provides powerful tools for elucidating C7orf53 function:

  • CRISPR/Cas9 gene editing:

    • Knockout studies in bovine cell lines

    • Knockin of reporter tags at endogenous loci

    • Introduction of specific mutations to test domain functions

  • Transcriptome analysis:

    • RNA-Seq of cells with modified C7orf53 expression

    • Similar to approaches used in pig liver transcriptome studies

    • Identification of affected pathways through gene set enrichment analysis

  • Proteome interaction studies:

    • Immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid or mammalian two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

  • Phenotypic screening:

    • Morphological changes

    • Alterations in cellular processes (proliferation, differentiation, migration)

    • Tissue-specific effects in 3D culture systems

Integration of these datasets provides a comprehensive view of C7orf53 function in bovine systems.

What bioinformatic approaches can identify conserved functional motifs in C7orf53 across species?

Comparative genomics provides insights into functional conservation:

  • Multiple sequence alignment: Using MUSCLE, T-Coffee, or MAFFT to align C7orf53 sequences from diverse species, identifying both highly conserved and rapidly evolving regions.

  • Motif identification: Using MEME, GLAM2, or SLiMFinder to detect short linear motifs that might mediate protein-protein interactions.

  • Selection analysis: Calculating dN/dS ratios to identify positions under purifying or positive selection, similar to approaches used in transcriptome studies .

  • Structural modeling: Using AlphaFold or RoseTTAFold to predict structures and compare conserved structural features across species.

  • Co-evolution analysis: Identifying residues that evolve in a coordinated manner, suggesting functional or structural relationships.

These approaches can reveal functional constraints and guide experimental design by highlighting the most promising regions for mutational studies.

How should researchers design experiments to determine if bovine C7orf53 forms homo-oligomers through its coiled-coil domains?

Oligomerization studies require multiple complementary techniques:

  • Analytical size exclusion chromatography: Comparing elution volumes of the purified protein against known standards to estimate molecular weight.

  • Chemical crosslinking: Using graduated concentrations of crosslinkers (DSS, BS3, formaldehyde) followed by SDS-PAGE analysis to capture transient interactions.

  • Förster resonance energy transfer (FRET): Using differentially labeled protein constructs to detect proximity in live cells.

  • Analytical ultracentrifugation: Providing definitive determination of oligomeric state and association constants.

  • Multi-angle light scattering (MALS): Coupled with size exclusion chromatography for accurate molecular weight determination.

For coiled-coil domains specifically, circular dichroism thermal melt experiments can reveal cooperative unfolding characteristic of interacting coiled-coils. Targeted mutations in the heptad repeat pattern (typically at 'a' and 'd' positions) can systematically disrupt oligomerization.

What approaches can be used to study the potential post-translational modifications of bovine C7orf53?

A comprehensive PTM analysis workflow includes:

  • Computational prediction: Using NetPhos, NetOGlyc, NetNGlyc to identify potential modification sites.

  • Mass spectrometry approaches:

    • Enrichment strategies for specific modifications (phosphopeptides, glycopeptides)

    • Multiple fragmentation methods (HCD, ETD) for comprehensive coverage

    • Quantitative approaches to determine stoichiometry

  • Site-directed mutagenesis: Mutating predicted sites to confirm functional significance.

  • Specific detection methods:

    • Phospho-specific antibodies

    • Periodic acid-Schiff staining for glycosylation

    • Pro-Q Diamond for phosphorylation

  • In vitro modification assays: Testing candidate kinases, glycosyltransferases, or other modifying enzymes.

This integrated approach can reveal the PTM landscape of C7orf53 and provide insights into its regulation.

How can RNA-Seq data be effectively analyzed to identify novel transcripts related to bovine C7orf53?

RNA-Seq analysis for novel transcript discovery should follow these steps:

  • Quality control and preprocessing: Trimming adaptors and low-quality reads before alignment.

  • Genome-guided assembly: Using tools like StringTie or Cufflinks to identify novel transcripts.

  • De novo assembly: Using Trinity or SOAPdenovo-Trans to capture transcripts missing from reference annotation.

  • Filtering strategy: Removing artifacts, contamination, and potential noise through expression thresholds and cross-sample reproducibility.

  • Coding potential assessment: Using tools like CPAT or CPC2 to distinguish coding from non-coding transcripts.

This approach successfully identified novel transcripts in pig liver studies, where unannotated intergenic expressed regions were detected and characterized . For C7orf53 specifically, attention should be paid to alternative transcription start sites, splice variants, and potential upstream open reading frames.

What are the considerations for developing specific antibodies against bovine C7orf53?

Effective antibody development strategies include:

  • Epitope selection:

    • Avoid transmembrane regions

    • Choose regions with low sequence similarity to other proteins

    • Select regions with high predicted antigenicity and surface exposure

    • Prioritize species-specific regions for bovine-specific antibodies

  • Antigen format options:

    • Synthetic peptides (typically 10-20 amino acids)

    • Recombinant protein fragments

    • Full-length protein (if expressible)

  • Validation requirements:

    • Western blotting against recombinant protein and endogenous expression

    • Immunoprecipitation efficiency testing

    • Immunofluorescence localization pattern assessment

    • Signal abolishment with competing peptide

    • Testing in knockout/knockdown systems

  • Cross-reactivity considerations:

    • Testing against multiple species if comparative studies are planned

    • Validation in tissues with known expression patterns

Monoclonal antibodies provide consistent results across experiments, while polyclonal antibodies may offer higher sensitivity but with batch-to-batch variability.

How can researchers design experiments to investigate potential interactions between bovine C7orf53 and other proteins?

A comprehensive interaction discovery workflow includes:

  • Unbiased approaches:

    • Affinity purification-mass spectrometry (AP-MS)

    • Proximity labeling (BioID, APEX)

    • Yeast two-hybrid screening

    • Protein complementation assays

  • Candidate approaches:

    • Co-immunoprecipitation of predicted partners

    • Förster resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Surface plasmon resonance for direct binding

  • Validation strategies:

    • Reciprocal co-immunoprecipitation

    • Co-localization studies

    • Functional assays measuring impact of disrupting interactions

    • Domain mapping to identify interaction interfaces

  • Mapping to cellular pathways:

    • Integration with protein-protein interaction databases

    • Network analysis to identify connection hubs

    • Gene Ontology enrichment of interaction partners

This multi-layered approach provides both discovery power and rigorous validation, thereby minimizing false positives that often plague interaction studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.