Recombinant Bovine Complement component C9 (C9)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Complement Component C9 (C9)

Recombinant bovine complement component C9 (C9) is a genetically engineered version of the terminal component of the complement system, critical for forming the membrane attack complex (MAC). It is synthesized through recombinant DNA technology, enabling precise control over its production and functional properties. Bovine C9 shares structural and functional similarities with human C9, including its role in immune defense and pathogen lysis. Below is a detailed analysis of its structure, function, production, and applications, supported by experimental data and research findings.

Production and Recombinant Engineering

Recombinant bovine C9 is typically produced via bacterial or mammalian expression systems (e.g., E. coli or COS-7 cells) . Key steps include:

  1. Cloning: Insertion of the bovine C9 gene into a plasmid vector.

  2. Expression: Induction of protein synthesis in host cells.

  3. Purification: Chromatographic techniques (e.g., affinity chromatography) .

Mutagenesis studies reveal critical residues for function:

  • N-terminal residues (1–16 amino acids): Essential for preventing spontaneous polymerization .

  • Cystine residues (C-terminal MACPF domain): Partial elimination does not impair hemolytic activity .

Role in Membrane Attack Complex (MAC) Formation

Bovine C9 polymerizes with C5b-8 to form transmembrane pores, disrupting osmotic balance in pathogens . Key observations include:

  • Polymerization: Requires C5b-8 binding and triggers a conformational shift in C9’s MACPF domain .

  • Pore Size: ~10 nm diameter, accommodating ions and small molecules .

Applications in Diagnostic and Therapeutic Research

ApplicationDetailsSource
ELISA KitsMeasure C9 levels in bovine serum/plasma for immune dysfunction studies
Nanopore TechnologyPoly(C9) forms stable nanopores for single-molecule analysis of proteins
Infectious Disease ModelsStudies on C9 deficiency in cattle linked to increased susceptibility to pathogens

Challenges and Limitations

  • Stability: Recombinant C9 may require stabilization in specific buffers (e.g., HEPES/NaCl) .

  • Specificity: Cross-reactivity with human C9 in assays (e.g., ELISA) necessitates species-specific validation .

  • Production Costs: High-yield expression in E. coli remains challenging due to disulfide bond requirements .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
C9; Complement component C9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-548
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
C9
Target Protein Sequence
GPTPSYDPAERQGTPLPIDCRMSSWSEWSKCDPCLKQMFRSRSIEIFGQFNGRKCVDAVG DRQQCVPTEACEDPEEGCGNDFQCGTGRCIKNRLLCNEDNDCGDYSDEDNCEQDPRPPCR NRVVEESELARTAGFGINILGMDPLSTPFDNQYYNGLCDRVWDGNTLTYYRRPWNVASLT YDTKADKNFRTENHEESIQILRTIIEEKKLNFNAGLSVKYTPVEAIEKNKCVDLEHSDKG STSSPSKLAAEAKFRFTYSKDDIYRLLSSYSAKQEKMFLHVKGKVHLGRFVMRSRDVMLQ TTFLDSINTLPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKKSMEQKDIELRD VQRCLGFDLDLSLKVGVEVTGNFDSKLCSKKGMGQTETNPEADLFDDVITFIRGGTRKYA TELKEKLLRGARMINVTDFVNWAASLNHAPVLISQKLVPIYDLIPVKMKDAHLKKQNLER AIEDYINEFSVRKCQPCQNGGTVVLLDGECVCSCPKEFKGVACEIKK
Uniprot No.

Target Background

Function

A component of the membrane attack complex (MAC), crucial for innate and adaptive immune responses. C9 forms pores in target cell plasma membranes, mediating cell lysis.

Database Links
Protein Families
Complement C6/C7/C8/C9 family
Subcellular Location
Secreted. Target cell membrane; Multi-pass membrane protein.

Q&A

What is bovine Complement component C9 and how does it compare to human C9?

Bovine Complement component C9 is a terminal complement pathway protein consisting of 527 amino acids (mature protein spans residues 22-548). Similar to human C9, it functions as the final component in the membrane attack complex (MAC). The recombinant version is typically expressed with an N-terminal His tag to facilitate purification . Human C9 contains 12 disulfide bonds distributed across four recognized domains: the TSP type-1 and LDL-receptor class A at the N-terminus, the MACPF in the center, and the EGF-like domain at the C-terminus . Both human and bovine C9 share functional similarities in MAC formation, though species-specific structural differences exist.

What is the physiological role of C9 in the complement cascade?

C9 serves as the final component of the complement cascade, responsible for the efficient expression of cytolytic and bacteriolytic functions. It assembles on target cell surfaces together with C5b, C6, C7, and C8 to form the C5b-9 complex or membrane attack complex (MAC) . While C5b-8 precursor complexes at high concentrations demonstrate weak hemolytic activity, the killing of nucleated cells and Gram-negative bacteria depends specifically on C9 . Upon binding to the C5b-8 complex, C9 undergoes a conformational change from a soluble protein to an integral membrane protein, forming transmembrane pores that disrupt the target cell membrane integrity.

What sequence motifs in C9 are critical for its functional activity?

Several key motifs in C9 determine its functional properties:

  • N-terminal domain (first 16 amino acids) - Crucial for preventing self-polymerization of the globular protein

  • WSEWS motif (residues 27-31 in human C9) - Shares similarity with cytokine receptors and membrane pore formers; mutation of this motif results in premature polymerization

  • MACPF domain - Central homologous region shared with C6, C7, C8α, and C8β that is essential for membrane insertion

  • Cysteine residues - Form 12 disulfide bonds that maintain structural integrity, though not all are essential for function

What expression systems are most effective for producing functional recombinant bovine C9?

The choice of expression system depends on research requirements:

Expression SystemAdvantagesLimitationsApplications
E. coliCost-effective, high yield, simple protocolsLimited post-translational modificationsStructural studies, antibody production
Insect cellsBetter folding, some post-translational modificationsModerate cost, more complexFunctional studies, glycosylation analysis
Mammalian cells (COS-7)Native-like glycosylation, proper foldingHigher cost, lower yieldsStudies requiring authentic modifications

Recombinant bovine C9 has been successfully expressed in E. coli with N-terminal His tags , while human C9 studies have utilized both insect cells and COS-7 mammalian expression systems .

What are the optimal storage conditions for preserving C9 activity?

For maximum stability and activity retention:

  • Store lyophilized recombinant C9 at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% recommended) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

Protein stability in Tris/PBS-based buffer (pH 8.0) with 6% trehalose has been demonstrated .

What methods can be used to assess C9 functional activity in MAC formation?

Several complementary approaches can evaluate C9's functional integrity:

  • Hemolytic assays: Measure erythrocyte lysis following addition of purified C9 to C9-depleted serum and target cells

  • Bactericidal assays: Assess killing of Gram-negative bacteria as a function of C9 concentration

  • C9 polymerization assays: Add C5b6 protein to cells followed by detection of MAC formation

  • Flow cytometry: Detect membrane-bound C9 on complement-lysed cells using specific antibodies

  • Immunofluorescence confocal microscopy: Visualize cellular C5b-9 formation and distribution

For quantitative assessment, researchers can measure relative hemolytic activity compared to native C9 or wild-type recombinant protein as a standard.

How can interactions between C9 and other complement components be characterized?

Methods for studying C9 interactions include:

  • ELISA-based binding assays: Coat complement proteins (C5b6, C7, C8, C9) on microtiter plates, add the test protein, and detect binding using specific antibodies

  • Dot blot procedures: Adsorb samples to nitrocellulose, block with "Blotto" solution, and incubate with anti-C9 antibodies (e.g., mAb216) followed by radiolabeled detection antibodies

  • Western blotting: Separate proteins by SDS-PAGE, transfer to nitrocellulose, and immunostain using anti-C9 antibodies and appropriate conjugates

  • C9 binding to C5b-8 sites: Measure increased binding to complement components on target cells

What concentration of C9 should be used for sublytic complement activation studies?

Determining appropriate sublytic concentrations is critical:

  • Published research indicates 3 μg/ml of immunopurified C9 in the presence of C9-depleted serum provides sublytic conditions

  • This concentration is substantially lower than the reported lytic dose of 20 μg/ml in K562 cells

  • Serum concentration of C9 in patients typically ranges from 10-15 μg/ml

  • Verification of sublytic conditions should be performed using lactate dehydrogenase (LDH) release assays to confirm minimal cell lysis

  • Optimal concentrations may vary by cell type and experimental conditions

How do N-terminal modifications affect C9 polymerization and function?

Research on human C9 has revealed the critical role of the N-terminus in regulating polymerization:

N-terminal ModificationEffect on PolymerizationFunctional Impact
Removal of 4-12 amino acidsNo spontaneous polymerization2-3 fold enhanced lytic activity; increased binding to C5b-8 sites
Removal of 16-23 amino acidsSpontaneous self-polymerizationInactivation of lytic function
Mutation of WSEWS motifPremature polymerizationDisruption of normal MAC formation

These findings indicate that the domain within the first 16 amino acids at the N-terminus of C9 is crucial in preventing self-polymerization while maintaining the protein in a functional state ready for controlled MAC formation .

What is the impact of glycosylation on C9 structure and function?

Studies on glycosylation modifications have provided important insights:

  • Aglycosyl-C9 retains hemolytic and bactericidal activity, indicating glycosylation is not essential for basic function

  • Introduction of new N-glycosylation sites (P26N, K311N/E313T) results in functional protein secreted at rates similar to wild-type

  • Some glycosylation sites (Y321N and E319N/Y321S) prevent protein secretion when expressed in COS-7 cells

  • Glycosylation at specific sites within the helix-turn-helix (HTH) fold does not interfere with membrane insertion, suggesting the glycan chain remains on the external side of the membrane

  • These properties make glycosylation an effective tool for studying C9 topology during MAC formation

What role do disulfide bonds play in C9 structure and function?

The disulfide bond arrangement in C9 has specific functional implications:

What are common technical challenges when working with recombinant C9?

Researchers should anticipate and prepare for these potential issues:

  • Premature polymerization: C9 may spontaneously polymerize if N-terminal regulatory domains are compromised

  • Expression variability: Different expression systems yield varying glycosylation patterns and folding efficiencies

  • Purification challenges: Metal affinity chromatography for His-tagged proteins may require optimization of elution conditions

  • Activity loss during storage: Protein degradation during freeze-thaw cycles requires careful aliquoting and stabilization

  • Batch-to-batch variability: Standardization against reference preparations is essential for consistency across experiments

What controls should be included in C9 functional assays?

Robust experimental design requires appropriate controls:

  • Positive controls: Native C9 or well-characterized recombinant wild-type C9

  • Negative controls:

    • C9-depleted serum to demonstrate specificity

    • Buffer-only treatments to assess background effects

    • Heat-inactivated C9 to control for non-specific protein interactions

  • Concentration controls: Titration series to establish dose-response relationships

  • Cell viability controls: Parallel viability assays to distinguish between lytic and non-lytic effects

  • Specificity controls: BSA or other irrelevant proteins at similar concentrations

How can recombinant C9 be validated for research applications?

Comprehensive validation should include:

  • SDS-PAGE analysis: Confirm >90% purity and expected molecular weight

  • Western blotting: Verify immunoreactivity with specific anti-C9 antibodies

  • Functional testing: Compare hemolytic activity to reference standards

  • Polymerization assessment: Evaluate ability to form poly-C9 complexes under appropriate conditions

  • Binding assays: Confirm interaction with other complement components (C5b-8)

  • Mass spectrometry: Verify amino acid sequence and post-translational modifications when applicable

For site-directed mutants or modified variants, comparative analysis with wild-type protein is essential to interpret functional changes accurately .

How can recombinant bovine C9 be utilized in comparative immunology studies?

Cross-species complement research offers valuable insights:

  • Comparative analysis of MAC formation mechanisms between bovine and human systems

  • Investigation of species-specific pathogens and their interactions with host complement

  • Development of models for bovine-specific diseases with complement involvement

  • Structure-function relationship studies leveraging evolutionary conservation and divergence

  • Identification of species-specific inhibitors or regulators of the terminal complement pathway

What emerging technologies are enhancing C9 and MAC research?

Recent methodological advances include:

  • Microfluidic immunoassays: Detection of shed C5b-9 in extracellular vesicles using capture by tetraspanin antibodies (CD9/CD63/CD81) and detection by surface-enhanced Raman scattering (SERS)

  • Genetic engineering approaches: CRISPR-Cas9 technology for studying C9 function in cellular contexts

  • Advanced imaging techniques: Super-resolution microscopy to visualize MAC assembly in real-time

  • Computational modeling: Prediction of protein-protein interactions and conformational changes during MAC formation

  • Systems biology approaches: Integration of complement pathways with broader immunological networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.