Recombinant Bovine coronavirus Hemagglutinin-esterase (HE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-421
Protein Length
Full Length of Mature Protein
Species
Bovine coronavirus (strain F15) (BCoV) (BCV)
Target Names
HE
Target Protein Sequence
FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVNTNPRNYSYMDLNPALCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVHSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYNNVSSVWPLYPYGRCPTAADIN TPDVPICVYDPLPLILLGILLGVAVIIIVVLLLYFMVENGTRL
Uniprot No.

Target Background

Function

Recombinant Bovine Coronavirus Hemagglutinin-Esterase (HE): A structural protein forming short surface spikes on the virus. It exhibits receptor-binding and receptor-destroying activities, mediating the de-O-acetylation of N-acetyl-4-O-acetylneuraminic acid—a crucial receptor determinant recognized by the virus on erythrocyte and susceptible cell surfaces. This receptor-destroying activity is essential for viral release, preventing self-aggregation and ensuring efficient cell-to-cell spread of progeny virions. HE may function as a secondary attachment protein, initiating infection alongside the primary spike protein. It is potentially a target for both humoral and cellular immune responses.

Protein Families
Influenza type C/coronaviruses hemagglutinin-esterase family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is Bovine Coronavirus Hemagglutinin-Esterase (HE)?

Bovine Coronavirus Hemagglutinin-Esterase (HE) is a structural protein that forms short spikes on the viral surface. It is a multifunctional protein containing both receptor-binding and receptor-destroying activities. The HE protein is also known by several alternative names in the scientific literature, including 2b, Hemagglutinin-esterase, HE protein, and E3 glycoprotein . From a structural perspective, HE is composed of two primary functional domains: an esterase domain and a lectin domain, with the latter being involved in receptor recognition .

When expressed recombinantly, HE protein is typically produced as a full-length protein with appropriate tags for purification and detection. For instance, commercially available recombinant HE proteins may be produced with histidine tags or other affinity tags such as StrepTag to facilitate purification while maintaining protein functionality .

What are the key molecular functions of the HE protein in BCoV pathogenesis?

The HE protein plays several critical roles in the viral life cycle and pathogenesis of Bovine Coronavirus:

  • Receptor binding activity: HE serves as a secondary viral attachment protein, complementing the primary attachment function of the spike protein .

  • Receptor-destroying enzyme activity: HE mediates de-O-acetylation of N-acetyl-4-O-acetylneuraminic acid, which is believed to be the receptor determinant recognized by the virus on erythrocytes and susceptible cells .

  • Virus release facilitation: The receptor-destroying activity is particularly important for virus release, as it prevents self-aggregation of viral particles and ensures efficient spread of progeny virus from cell to cell .

  • Immune system target: HE may become a target for both the humoral and cellular branches of the immune system, making it relevant for vaccine development and immunological studies .

  • Strain differentiation: Variations in the HE gene, particularly recombination events, can contribute to strain diversity and potentially affect viral tropism and pathogenicity .

How is recombinant HE protein typically expressed and purified for research applications?

Recombinant HE protein can be expressed in multiple systems, each with specific advantages for different research applications:

Expression Systems:

Expression SystemAdvantagesConsiderationsExamples
YeastHigh yield, post-translational modifications, cost-effectiveDifferent glycosylation patterns from mammalian cellsRecombinant BCoV HE with >90% purity expressed in yeast
Mammalian cells (e.g., Expi293)Native-like post-translational modifications, proper foldingHigher cost, potentially lower yieldBCoV strain L9 HE (aa 17-392) expressed in Expi293 cells
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modifications, potential folding issuesUsed for multiepitope-based vaccine candidates

Purification Methods:

  • Affinity chromatography: Typically utilizing His-tag or Strep-tag affinity purification methods .

  • Size exclusion chromatography: Often used as a secondary purification step to enhance purity.

  • Ion exchange chromatography: May be employed depending on the protein's properties.

For optimal results, expression of recombinant HE in mammalian cells like Expi293 followed by affinity purification (e.g., Streptactin-purification for StrepTag-equipped proteins) can yield highly pure (>95%) functional protein . The purified protein can then be equipped with additional tags like SpyTag for specific research applications .

What methodologies are effective for analyzing HE recombination events in BCoV strains?

Recombination events in the HE gene of BCoV are significant evolutionary mechanisms that can affect viral properties. Research from China has identified recombination events between the esterase and lectin domains in BCoV strains, highlighting the importance of thorough analytical methods .

Effective methodological approaches include:

  • Full-length gene sequencing: Complete HE gene sequencing rather than partial sequencing is essential for detecting recombination events. Studies have shown that full-length spike, HE, nucleocapsid, and transmembrane genes provide comprehensive data for evolutionary analysis .

  • Recombination detection software: Programs such as RDP4, SimPlot, and Bootscan are commonly used to identify potential recombination breakpoints.

  • Phylogenetic analysis: Construction of phylogenetic trees using different regions of the HE gene (pre- and post-recombination points) can reveal inconsistencies indicative of recombination events.

  • Multiple sequence alignment: Detailed comparative analysis of amino acid sequences can identify shared variations that may result from recombination, such as the F181V variant in the R2-loop and S158A variant in the R1-loop observed in recombinant BCoV strains in China .

  • Structural analysis: Mapping recombination sites to protein structural domains can provide insights into functional implications of recombination events.

A comprehensive approach should incorporate these methods to fully characterize recombination in the HE gene. The prevalence of recombinant HE strains (10 out of 13 strains in one study) underscores the importance of monitoring these events in epidemiological surveillance .

How can computational tools be applied to map immunogenic properties of the HE protein?

Advanced computational tools have revolutionized the analysis of immunogenic properties of viral proteins like BCoV HE. These approaches provide valuable insights for vaccine development and understanding host-pathogen interactions.

Key computational approaches include:

  • Machine learning-based epitope prediction: These tools can identify potential B-cell and T-cell epitopes within the HE protein sequence. AlphaFold2 has been successfully employed to predict the tertiary structure of BCoV vaccine candidates, including HE-based constructs .

  • Immune simulation platforms: C-ImmSim (v10.1 server) can be utilized to analyze the immunogenic properties and interactions between designed BCoV vaccine candidates and viral proteins. This allows researchers to simulate immune responses at several time intervals and predict the stimulation of cytotoxic T cells, helper T cells, B cells, and other immune cells .

  • Structural validation tools: Ramachandran plots and Z-score analysis are essential for validating the structural quality of developed models. These tools ensure the stability and reliability of antigen design by confirming that residues are in the most advantageous parts of the protein model .

  • Molecular docking simulations: Programs like Z docker can evaluate binding interactions between HE-based vaccine candidates and Toll-like receptors (TLRs). The results from these simulations can reveal binding affinities and help understand how the protein might interact with the host immune system .

  • Codon optimization software: Tools like Vector Builder can optimize codons for expression in specific systems (e.g., E. coli K-12 strain), enhancing protein production efficiency .

Implementation of these computational approaches can significantly accelerate vaccine development by identifying promising epitopes and predicting immune responses before experimental validation.

What expression systems are optimal for producing functional recombinant HE protein?

Selecting the appropriate expression system is crucial for obtaining functional recombinant HE protein. Different systems offer distinct advantages depending on the intended application.

Comparative analysis of expression systems:

Expression SystemAdvantagesLimitationsOptimal ApplicationsCitation
Mammalian cells (Expi293)- Native-like post-translational modifications
- Proper protein folding
- High purity (>95%)
- Preservation of conformational epitopes
- Higher cost
- Potentially lower yield
- More complex culture conditions
- Structural studies
- Vaccine development
- Neutralization assays
- Receptor binding studies
Yeast- High yield
- Cost-effective
- Some post-translational modifications
- Suitable for SDS-PAGE analysis
- Different glycosylation patterns from mammalian cells
- Potential hyperglycosylation
- Biochemical assays
- Antibody generation
- High-throughput screening
E. coli- Rapid expression
- High yield
- Cost-effective
- Simplified purification
- Limited post-translational modifications
- Potential inclusion body formation
- Potential endotoxin contamination
- Epitope-based vaccines
- Protein interaction studies
- Enzymatic activity assays

For functional studies focusing on receptor-binding and receptor-destroying activities, mammalian expression systems like Expi293 cells are generally preferred as they provide protein with native-like post-translational modifications and proper folding . These systems are particularly valuable when conformational epitopes or enzymatic activities need to be preserved.

For applications where high yield is prioritized over perfect native conformation, yeast expression systems can provide a good balance between yield and functionality . E. coli systems are particularly suitable for expressing defined epitopes or domains of the HE protein rather than the full-length functional protein .

What are effective protocols for measuring HE receptor-binding and receptor-destroying activities?

Measuring the dual functions of HE—receptor binding and receptor destroying (esterase) activities—requires specific methodological approaches. Below are established protocols for assessing these activities:

Receptor-Binding Activity Assays:

  • Hemagglutination Assay:

    • Prepare serial dilutions of purified recombinant HE protein

    • Add equal volumes of 0.5% mouse erythrocyte suspension

    • Incubate at 4°C for 2 hours

    • Observe hemagglutination patterns

    • Results are expressed as hemagglutination units (HAU)

  • Solid-Phase Binding Assay:

    • Coat ELISA plates with bovine submaxillary mucin or synthetic 9-O-acetylated sialic acid-containing glycans

    • Add serial dilutions of recombinant HE protein

    • Detect bound protein using anti-tag antibodies

    • Quantify binding affinity through EC50 determination

Receptor-Destroying (Esterase) Activity Assays:

  • Acetylesterase Assay:

    • Substrate: p-nitrophenyl acetate (pNPA)

    • Add recombinant HE to substrate solution

    • Measure release of p-nitrophenol spectrophotometrically at 405 nm

    • Calculate specific activity in μmol/min/mg protein

  • Receptor Destruction Assay:

    • Pre-treat erythrocytes or mucin-coated plates with HE protein

    • Perform hemagglutination or binding assay

    • Compare with untreated controls to determine degree of receptor destruction

    • Results indicate efficiency of de-O-acetylation

These assays are essential for characterizing recombinant HE proteins and evaluating their potential for vaccine development or as targets for antiviral strategies. The dual functionality of HE in both binding to and modifying receptors makes it particularly relevant for understanding viral attachment and release mechanisms in BCoV infections .

How can computational methods enhance HE-based vaccine design?

Computational methods have significantly advanced the design of HE-based vaccine candidates by enabling more precise epitope selection and predicting immune responses. A systematic computational approach to HE-based vaccine design includes:

  • Multi-epitope Vaccine Design Pipeline:

    • Epitope prediction for B-cell, helper T-cell (HTL), and cytotoxic T-cell (CTL) responses

    • Incorporation of adjuvants (e.g., Cholera toxin subunit B) and appropriate linkers (EAAAK, AAY, GPGPG)

    • Integration of the PADRE sequence to enhance helper T-cell responses

  • Structural Prediction and Validation:

    • AlphaFold2 for tertiary structure prediction of vaccine constructs

    • Ramachandran plot analysis to validate structural quality

    • Z-score evaluation to select optimal models and confirm stability

  • Immune Response Simulation:

    • Utilization of C-ImmSim server to predict immune responses over time

    • Evaluation of primary and secondary immune responses (B cells, T cells, cytokines)

    • Comparison of different vaccine constructs to identify those with optimal immunogenicity profiles

  • Molecular Docking Analysis:

    • Z docker protein-protein interaction analysis to evaluate binding between vaccine candidates and Toll-like receptors (TLRs)

    • Energy minimization using CharmM force fields

    • Selection of binding poses with favorable energy values (e.g., -8.3 kcal/mol)

  • Codon Optimization and In Silico Cloning:

    • Vector Builder for codon optimization tailored to the expression system (e.g., E. coli K-12)

    • Snap Gene tools for simulating the cloning process

    • Selection of appropriate vectors (e.g., pET-28a(+)) for expression

By integrating these computational approaches, researchers can design multi-epitope vaccines that incorporate the most immunogenic regions of the HE protein while optimizing expression, stability, and immune recognition. These methods reduce the time and resources required for experimental validation by prioritizing the most promising vaccine candidates for further development.

What quality control parameters should be evaluated for recombinant HE protein preparations?

Ensuring the quality and functionality of recombinant HE protein preparations is essential for reliable research outcomes. The following quality control parameters should be systematically evaluated:

Essential Quality Control Parameters:

ParameterMethodAcceptance CriteriaRelevance
PuritySDS-PAGE, Size Exclusion Chromatography>90% for standard applications, >95% for structural studies Ensures experimental results are not influenced by contaminants
IdentityWestern Blot, Mass SpectrometryCorrect molecular weight, positive reactivity with specific antibodiesConfirms the protein is indeed HE
Structural IntegrityCircular Dichroism, Thermal Shift AssaySecondary structure content consistent with predictions, stable melting temperatureIndicates proper folding
Functionality - Receptor BindingHemagglutination Assay, Glycan Binding AssayDose-dependent binding to 9-O-acetylated sialic acidsConfirms lectin domain functionality
Functionality - Esterase ActivitypNPA Hydrolysis AssaySpecific activity consistent with reference standardsVerifies enzyme domain functionality
Endotoxin ContentLAL Assay<1 EU/mg for in vitro studies, <0.1 EU/mg for in vivo studiesPrevents endotoxin interference in immunological studies
Aggregation StateDynamic Light Scattering, Size Exclusion ChromatographyPredominantly monomeric or native oligomeric stateEnsures proper quaternary structure

Additional Parameters for Specific Applications:

  • For structural studies: Homogeneity assessment by negative-stain electron microscopy

  • For immunological studies: Confirmation of epitope presentation by ELISA using conformation-specific antibodies

  • For receptor interaction studies: Surface plasmon resonance to determine binding kinetics (kon and koff rates)

  • For vaccine development: Stability under storage conditions and thermal stress testing

Recombinant HE proteins that meet these quality control parameters can be confidently used in downstream applications. For example, commercially available recombinant HE proteins typically specify purity levels (>90% for standard applications) and expression systems used (yeast, mammalian cells) , which inform researchers about the expected quality and functionality of the preparation.

How does HE genetic diversity impact vaccine development strategies?

The genetic diversity of Bovine Coronavirus HE protein, particularly through recombination events, poses significant challenges and opportunities for vaccine development. Understanding this diversity is crucial for designing broadly protective vaccines.

Impact of HE Diversity on Vaccine Development:

  • Recombination Events as Evolutionary Drivers:
    Recent studies have identified novel BCoV strains with recombinant HE genes, with recombination sites specifically located between the esterase and lectin domains . This recombination appears to be widespread, with 10 out of 13 strains in one study showing identical recombination patterns . Such genetic reshuffling can potentially alter epitope presentation and antigenicity.

  • Conserved vs. Variable Regions:
    Despite recombination events, certain regions remain conserved across BCoV strains. These conserved regions, particularly within the enzymatic domain, represent high-value targets for universal vaccine design. Conversely, variable regions, especially in the lectin domain, may require multi-valent vaccine approaches.

  • Amino Acid Variants in Functional Domains:
    Specific amino acid variations, such as F181V in the R2-loop and S158A in the R1-loop of the HE gene, have been identified in recombinant strains . These variations occur in regions potentially involved in receptor binding and may alter viral tropism or immune recognition.

  • Multi-epitope Vaccine Strategies:
    Given the diversity in HE sequences, computational approaches have been employed to design multi-epitope vaccines that incorporate conserved B-cell, helper T-cell, and cytotoxic T-cell epitopes from various structural proteins, including HE . This approach aims to elicit broad immune responses against diverse viral strains.

Future Directions in HE-based Vaccine Development:

  • Surveillance of HE Genetic Diversity: Continuous monitoring of circulating BCoV strains to track emerging recombination events and amino acid variations in the HE gene.

  • Structure-Based Vaccine Design: Utilization of AlphaFold2 and similar tools to predict how genetic variations affect HE protein structure and epitope presentation .

  • Immune Response Prediction: Application of C-ImmSim and other computational tools to predict how HE genetic diversity impacts immune recognition and response patterns .

  • Recombinant HE Production Optimization: Development of expression systems that yield high-quality HE proteins representing diverse genetic variants for vaccine formulation.

By addressing these aspects, researchers can develop more effective vaccines against BCoV that account for the genetic diversity and evolutionary patterns of the HE protein, potentially leading to broader and more durable protection against diverse viral strains.

What are the latest techniques for studying HE protein-host cell interactions?

Understanding the interactions between BCoV HE protein and host cells is crucial for elucidating viral pathogenesis and developing intervention strategies. Recent technological advances have enhanced our ability to study these interactions with unprecedented precision.

Cutting-edge Techniques for HE-Host Interaction Studies:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of HE protein structure at near-atomic resolution

    • Allows observation of HE-receptor complexes in different conformational states

    • Provides insights into the structural basis of receptor binding and enzymatic activity

  • Glycan Microarrays:

    • High-throughput screening of HE binding to diverse sialylated glycans

    • Identification of specific glycan structures recognized by different HE variants

    • Comparison of receptor preferences across BCoV strains with different HE sequences

  • CRISPR-Cas9 Host Cell Engineering:

    • Generation of cell lines with specific glycosyltransferase knockouts

    • Creation of cells expressing modified sialic acids to study specificity of HE binding

    • Investigation of host factors involved in HE-mediated entry or release

  • Biolayer Interferometry and Surface Plasmon Resonance:

    • Real-time measurement of HE-receptor binding kinetics

    • Determination of association and dissociation rates

    • Evaluation of how amino acid variations affect binding affinity

  • Advanced Molecular Docking and Simulation:

    • Z docker protein-protein interaction analysis for studying HE binding to host receptors

    • Molecular dynamics simulations to analyze the conformational changes during receptor binding and enzymatic activity

    • Evaluation of binding energies to predict interaction strength

  • Single-Molecule Techniques:

    • Fluorescence resonance energy transfer (FRET) to study conformational changes during HE-receptor interaction

    • Optical tweezers to measure forces involved in HE-receptor binding

    • Single-particle tracking to visualize HE-mediated entry processes

These advanced techniques provide researchers with powerful tools to elucidate the molecular details of HE-host interactions, potentially revealing new targets for therapeutic intervention and improving our understanding of BCoV pathogenesis.

How can researchers address difficulties in obtaining functional recombinant HE protein?

Researchers often encounter challenges when producing functional recombinant HE protein. Here are systematic approaches to troubleshoot common issues:

Expression Yield Challenges:

  • Problem: Low expression levels in selected system
    Solutions:

    • Optimize codon usage for the expression host using tools like Vector Builder

    • Adjust induction conditions (temperature, inducer concentration, duration)

    • Test different promoters or expression vectors (e.g., pET-28a(+))

    • Consider alternative expression systems if current system consistently yields poor results

  • Problem: Protein aggregation or inclusion body formation
    Solutions:

    • Reduce expression temperature (e.g., from 37°C to 16-20°C)

    • Co-express with molecular chaperones

    • Express as a fusion with solubility-enhancing tags (e.g., MBP, SUMO)

    • For mammalian expression, use specialized cell lines like Expi293

Purification Challenges:

  • Problem: Poor binding to affinity resins
    Solutions:

    • Ensure tag is accessible (consider adding flexible linkers)

    • Optimize binding buffer conditions (pH, salt concentration)

    • Test alternative tag positions (N-terminal vs. C-terminal)

    • For StrepTag-purified proteins, ensure Streptactin columns are fresh and not saturated

  • Problem: Co-purification of contaminants
    Solutions:

    • Implement multi-step purification strategy

    • Include wash steps with increased salt or low concentrations of imidazole

    • Consider size exclusion chromatography as a polishing step

    • Use higher stringency conditions for elution

Functionality Issues:

  • Problem: Recombinant protein lacks hemagglutination activity
    Solutions:

    • Verify protein folding using circular dichroism

    • Ensure all disulfide bonds are correctly formed

    • Check for presence of post-translational modifications

    • Consider mammalian expression systems that better preserve native conformation

  • Problem: Low or absent esterase activity
    Solutions:

    • Verify pH conditions are optimal for enzyme activity

    • Ensure no inhibitors are present in buffer

    • Test different substrate concentrations

    • Consider adding stabilizing agents to prevent activity loss during storage

Case Study: Successful Expression Strategy

For optimal results with BCoV HE protein, researchers have successfully used:

  • Expression of amino acids 17-392 of BCoV strain L9 HE in Expi293 cells

  • Streptactin purification of StrepTag-equipped protein

  • Addition of c-terminal SpyTag for specialized applications

  • This approach yielded >95% pure, functional protein

By systematically addressing these challenges, researchers can significantly improve their chances of obtaining functional recombinant HE protein for their studies.

What strategies can overcome limitations in computational prediction of HE protein structure and function?

Computational prediction of HE protein structure and function, while powerful, comes with inherent limitations. Researchers can employ several strategies to overcome these challenges:

Overcoming Structural Prediction Limitations:

  • Challenge: Limited accuracy in predicting highly flexible regions
    Solutions:

    • Combine AlphaFold2 predictions with molecular dynamics simulations to explore conformational flexibility

    • Use ensemble modeling approaches that generate multiple possible conformations

    • Validate predictions experimentally using limited proteolysis to identify flexible regions

  • Challenge: Difficulty in predicting protein-glycan interactions
    Solutions:

    • Incorporate specialized carbohydrate force fields into modeling

    • Use template-based modeling when structures of homologous lectin domains are available

    • Validate predictions with experimental glycan array data

  • Challenge: Uncertainty in quaternary structure prediction
    Solutions:

    • Use protein-protein docking to model potential oligomeric states

    • Incorporate experimental data (e.g., crosslinking mass spectrometry) as constraints

    • Employ integrative modeling approaches that combine multiple data sources

Enhancing Functional Prediction Accuracy:

  • Challenge: Limited accuracy in epitope prediction
    Solutions:

    • Combine multiple epitope prediction algorithms instead of relying on a single method

    • Incorporate evolutionary conservation analysis to identify functionally important regions

    • Validate predictions using experimental techniques like peptide arrays or phage display

  • Challenge: Uncertainty in predicting immune responses
    Solutions:

    • Use multiple immune simulation platforms beyond C-ImmSim

    • Calibrate simulation parameters based on experimental data when available

    • Integrate population-specific HLA typing data for more accurate T-cell epitope predictions

  • Challenge: Limitations in molecular docking accuracy
    Solutions:

    • Perform consensus docking using multiple algorithms beyond Z docker

    • Incorporate receptor flexibility in docking simulations

    • Validate docking predictions with experimental binding assays

Integrative Approaches:

  • Challenge: Disconnection between computational predictions and experimental reality
    Solutions:

    • Implement iterative cycles of prediction and experimental validation

    • Develop machine learning models trained on experimental data specific to coronavirus proteins

    • Use experimental structures of related coronavirus proteins as templates when available

  • Challenge: Difficulty in predicting effects of mutations or recombination
    Solutions:

    • Develop specialized models for recombination hotspots like those between the esterase and lectin domains

    • Perform comparative analysis of natural variants to identify patterns in functional changes

    • Use deep mutational scanning data to train predictive models when available

By implementing these strategies, researchers can enhance the reliability of computational predictions for HE protein structure and function, leading to more effective experimental design and interpretation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.