Recombinant Bovine coronavirus Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for prioritized development.
Synonyms
M; 6; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV)
Target Names
M
Target Protein Sequence
MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITVILQFGYTSRSMFVYVIKMIILW LMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNPE TNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKVS HLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGLDTALLRNNI
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Protein Families
Betacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of BCoV M protein and how does it compare to other coronavirus M proteins?

BCoV M protein is a 25 kDa structural protein that spans the viral envelope . Structural studies of coronavirus M proteins reveal a common architecture consisting of three transmembrane helices (TM1, TM2, TM3) with an N-terminal ectodomain and a C-terminal endodomain that extends into the virion interior .

Recent cryo-electron microscopy studies of the related SARS-CoV-2 M protein show it forms a mushroom-shaped dimer composed of:

  • Two transmembrane domain-swapped three-helix bundles

  • Two intravirion domains with β-sheet sandwich domains (BD)

  • A juxtamembrane hinge region (residues 106-116) critical for conformational changes

The dimerization occurs through domain-swapping where TM1 in one protomer forms a three-helix bundle with TM2 and TM3 in the other protomer . This structure is likely conserved across betacoronaviruses, with BCoV M protein showing significant sequence homology to other coronavirus M proteins.

What domains of the M protein are essential for its function in virus assembly?

The M protein contains several functional domains critical for virus assembly:

  • Transmembrane Domain: The three transmembrane helices (TM1, TM2, TM3) form the scaffold for membrane attachment and contribute to viral envelope formation .

  • Hinge Region: A highly conserved region that mediates conformational changes between long and short forms of the M protein dimer. Deletion of this region inhibits virus formation despite not impairing interactions with other viral proteins, indicating its essential role in assembly .

  • C-terminal Domain (CTD): The intravirion domain is critical for interactions with other viral components, particularly the nucleocapsid (N) protein and viral RNA .

  • Basic Patches in the Intravirion Domain: Mutation studies have identified specific basic regions in the M protein important for N protein interaction :

    • Basic patches at the entrance of the upper cavity vestibule (mutant #2) showed no binding to N protein

    • Juxtamembrane residues near the entrance of the upper cavity vestibule (mutant #4) showed weak binding

    • BD truncated forms (mutants #6 and #7) showed no binding

These findings demonstrate that the BD domain is essential for recruiting N protein during virus assembly, with specific charged residues mediating the interaction .

What are the optimal expression systems for producing recombinant BCoV M protein?

Several expression systems have been evaluated for M protein production, each with distinct advantages:

Expression SystemAdvantagesDisadvantagesReference
HEK293 cellsProper folding, glycosylation, monodisperse peaks in gel filtrationHigher cost, longer production time
E. coliHigh yield, cost-effective, simple protocolsPotential improper folding, lack of post-translational modifications
Baculovirus/insect cellsHigh expression levels, proper folding, suitable for structural studiesComplex system, moderate cost
CHO-K1 cellsSecreted expression possible, proper glycosylationHigher cost, complex protocols

For structural studies, the HEK293 expression system solubilized with either LMNG/CHS or GDN detergents has proven effective, yielding monodisperse peaks in gel filtration purification . For immunological studies and vaccine development, both eukaryotic (CHO-K1) and prokaryotic (E. coli) systems have been successfully employed .

Recombinant expression in bacterial systems (E. coli K-12 strain) can be optimized using codon optimization tools such as Vector Builder and Snap Gene for cloning into compatible plasmid vectors like pET-28a(+) .

What purification strategies yield the highest purity and functional activity of recombinant M protein?

A systematic purification strategy involves:

  • Extraction and Solubilization:

    • For membrane-bound M protein, detergent solubilization using either LMNG/CHS or GDN has proven effective

    • Different detergents affect oligomeric state: GDN-solubilized M protein contained a small portion (<10%) in higher oligomeric states

  • Chromatography Techniques:

    • Affinity chromatography (His-tagged purification) for initial capture

    • Size exclusion chromatography to separate different oligomeric states

    • Ion exchange chromatography for final polishing

  • Functional Validation:

    • Immunoprecipitation assays using BCV-specific polyclonal antisera

    • Western blot analysis with 6×His monoclonal antibody for tag detection

    • Structural integrity assessment by cryo-EM for high-resolution studies

For secreted recombinant constructs, CHO-K1 cells can be transfected with pcDNA3.1-derived vectors to produce secreted proteins that can be harvested directly from culture supernatants .

How does the M protein interact with other viral proteins during virion assembly?

The M protein orchestrates viral assembly through specific interactions with multiple viral components:

  • M-N Protein Interactions:

    • The basic intravirion surface of the M protein interacts with the C-terminus of the N protein

    • Mutational studies identified specific regions in the M protein's BD domain that are critical for N protein binding

    • The interaction analysis indicates that the carboxy-terminus of the N protein mediates its interaction with M protein

  • M-RNA Interactions:

    • The positively charged intravirion domain mediates RNA recruitment

    • M protein facilitates the concerted recruitment of N protein and RNA through this domain

  • M-M Interactions:

    • M proteins form dimers and higher-order oligomers (tetramers, hexamers)

    • A conserved domain (CD) in the M protein tail is important for M-M interactions

    • Mutations in this domain (e.g., E121R and E121K) disrupt VLP formation, while recovered mutants (E121Q and E121L) remain competent for assembly

  • M-E Protein Interactions:

    • Co-expression of M and E proteins is sufficient for the formation of virus-like particles

    • The interaction is critical for envelope formation and virus morphogenesis

These interactions collectively drive the assembly process, with M protein serving as the central organizer that brings together the various viral components.

What conformational states does the M protein adopt and how do they influence viral assembly?

The M protein exists in at least two distinct conformational states that play different roles in virus assembly:

  • Long Form:

    • Characterized by extended transmembrane helices and a more rigid conformation

    • Responsible for the rigidity and narrow curvature of the viral envelope

    • Involved in recruitment of the S protein

    • May be stabilized by specific lipid-protein interactions

  • Short Form:

    • More compact conformation with different arrangement of transmembrane helices

    • Provides flexibility and contributes to lower spike density

    • Both forms appear to be prerequisites for proper virus assembly

The transition between these conformations is mediated by the highly conserved hinge region (residues 106-116), deletion of which inhibits virus formation . Interestingly, even though hinge region deletion does not impair M-N protein interaction, it prevents proper virus assembly, indicating that conformational flexibility is essential for the assembly process .

Cryo-EM studies have observed tandemly arranged M protein oligomers that induce membrane curvature, potentially contributing to the spherical morphology of virions .

How effective is recombinant M protein as a target for serological diagnostics?

Recombinant M protein has demonstrated significant utility in serological diagnostics:

  • ELISA Applications:

    • IgM and IgG ELISA tests based on recombinant M protein show good diagnostic performance for coronavirus detection

    • Tests using truncated recombinant M protein (comprising the N-terminal region 1-19 aa and C-terminal region 101-222 aa) have demonstrated strong immunoreactivity with sera from COVID-19 convalescents

  • Epitope Mapping:

    • Five continuous protein epitopes have been predicted in the M protein using BEPITOP program

    • The primary structure of SARS-CoV-2 M protein shows 91% sequence identity with SARS-CoV M protein, suggesting immunological cross-reactivity

  • Specificity and Sensitivity:

    • Properly folded recombinant M protein expressed in eukaryotic systems shows higher sensitivity in diagnostic applications compared to bacterially expressed proteins

    • Indirect ELISA methods based on viral structural proteins can achieve high specificity with no cross-reactivity with other bovine-associated virus sera

The immunoreactivity of recombinant M protein makes it valuable for developing diagnostic tools, particularly when combined with other viral antigens for comprehensive antibody detection.

What is the role of M protein in vaccine development compared to other structural proteins?

While the S protein has been the primary focus for coronavirus vaccine development, the M protein offers several advantages as a vaccine component:

  • Sequence Conservation:

    • M protein mutates more slowly compared to S protein, making it less susceptible to immune evasion

    • S proteins of SARS-CoV-2 and Bat coronavirus RaTG13 show 97.41% sequence identity, whereas M proteins show 99.55% identity

    • Only minor mutations (e.g., I82T in Delta variant) have been observed in the M protein

  • Synergistic Immune Response:

    • Studies evaluating recombinant vaccines containing both S and M proteins show a more robust immune response compared to either protein alone

    • In sheep inoculated with recombinant adenoviruses expressing BCoV S protein (AdV-BCoV-S), BCoV M protein (AdV-BCoV-M), or both proteins (AdV-BCoV-S+M), the combined vaccine induced the strongest neutralizing antibody response

    • Serum neutralization titers increased from 1:27.5 at day 21 to 1:90 at day 28 in sheep inoculated with both S and M proteins, showing a significant difference in immune response (F=20.47; p<0.001)

  • Multi-epitope Vaccine Approaches:

    • Computational approaches have identified multiple B-cell and T-cell epitopes in the M protein suitable for vaccine development

    • Several methodologies for constructing multi-epitope vaccines incorporate M protein epitopes linked to adjuvants such as Cholera toxin subunit B

    • These constructs can be designed to interact with Toll-like receptors (TLR2 and TLR4) with binding energy values between -7.9 and -9.4 eV

  • Expression Systems for Vaccine Production:

    • Recombinant BAV-3 (bovine adenovirus) vectors can express BCoV proteins including M protein

    • Expression can be optimized using different promoters (SV40 or CMV immediate early promoters) and exogenous chimeric introns

Including M protein in vaccine formulations provides broadened immune coverage and potentially greater resistance to viral escape mutations compared to S protein-only vaccines.

How can structural insights into M protein be utilized for therapeutic intervention?

Structural studies of the M protein reveal several potential targets for therapeutic intervention:

  • Targeting Conformational States:

    • The distinct conformational states of M protein (long and short forms) can be selectively stabilized by antibodies or small molecules

    • Therapeutic molecules that stabilize a specific conformation of M protein could potentially block virus assembly

    • The space between the transmembrane region and BD domain (i.e., the vestibule and upper cavity) offers an attractive target site

  • Disrupting M-N Interactions:

    • The interaction between M and N proteins is essential for virus assembly

    • The basic patches in the intravirion domain of M protein that interact with N protein can be targeted with specific inhibitors

    • Mutations in these regions impair N protein binding and could inform the design of peptide-based inhibitors

  • Blocking M Protein Oligomerization:

    • M protein forms higher-order oligomers essential for virus assembly

    • The interface between M protein dimers represents a potential target for small-molecule inhibitors

    • Disrupting M-M interactions would prevent the formation of the viral envelope

  • Computational Design Approaches:

    • In silico screening can identify potential inhibitors targeting the M protein

    • Molecular docking studies, as demonstrated with TLR interactions, can predict binding affinities of potential therapeutic molecules

    • Structure-based drug design focusing on the conserved regions of M protein could lead to broad-spectrum antivirals effective against multiple coronaviruses

The slower mutation rate of M protein compared to S protein makes it an attractive therapeutic target with potentially lower susceptibility to escape mutations .

What methodologies are most effective for studying M protein-mediated membrane curvature and viral morphogenesis?

Several complementary approaches can be employed to study M protein's role in membrane curvature and viral morphogenesis:

  • Cryo-Electron Microscopy and Tomography:

    • Cryo-EM has successfully revealed the structure of M protein dimers in different conformations

    • Cryo-electron tomography can visualize M protein arrangements in the context of intact virions or virus-like particles

    • These techniques have shown tandemly arranged M protein oligomers that induce membrane curvature

  • Lipid Nanodisc Reconstitution:

    • Reconstituting M protein in lipid nanodiscs provides a native-like membrane environment

    • This approach has been used to study the short form of SARS-CoV-2 M protein

    • Lipid composition can be varied to study how specific lipids influence M protein conformation and function

  • Virus-Like Particle (VLP) Systems:

    • Co-expression of M and E proteins leads to VLP formation, providing a simplified system to study assembly

    • The effects of M protein mutations on VLP morphology can be assessed using:

      • Negative staining electron microscopy

      • Cryo-EM

      • Dynamic light scattering for size distribution analysis

  • Fluorescence Microscopy Techniques:

    • Fluorescently labeled M protein can be used to study its dynamics in living cells

    • Super-resolution microscopy can resolve M protein clusters during assembly

    • FRET-based approaches can detect M protein interactions with other viral components

  • Computational Modeling:

    • Molecular dynamics simulations can model M protein-membrane interactions

    • Coarse-grained simulations can capture membrane deformation on longer timescales

    • Integrative modeling approaches can combine experimental data with simulations

These methodologies, used in combination, provide comprehensive insights into how M protein orchestrates membrane curvature and determines viral morphology.

What are the critical controls needed when working with recombinant BCoV M protein?

Robust experimental design with appropriate controls is essential when working with recombinant M protein:

  • Expression System Controls:

    • Untransfected cell lysates/supernatants to control for host cell protein contamination

    • Cells expressing irrelevant proteins (e.g., eGFP) to control for general effects of protein overexpression

    • For studies involving multiple viral proteins, individual protein expression controls to distinguish their specific contributions

  • Structural Integrity Controls:

    • Circular dichroism spectroscopy to verify secondary structure

    • Size exclusion chromatography to assess oligomeric state

    • Thermal stability assays to confirm proper folding

    • Native PAGE compared to denatured samples to verify conformational states

  • Functional Assay Controls:

    • For interaction studies:

      • M protein mutants with known effects on protein binding (e.g., mutants #1-7 for N protein interaction)

      • Truncated M protein variants lacking specific domains

      • Competition assays with synthetic peptides corresponding to interaction domains

  • Immunological Study Controls:

    • Pre-immune sera for antibody studies

    • Sera against related coronaviruses to test for cross-reactivity (e.g., BVDV, BRV, BRSV, BHV-1)

    • Positive and negative control samples with established reactivity

  • Imaging Controls:

    • For immunofluorescence:

      • Primary antibody controls (no primary antibody)

      • Secondary antibody controls (irrelevant primary antibody)

      • Nuclear staining with DAPI to visualize cell boundaries

Implementing these controls ensures experimental rigor and helps distinguish specific M protein effects from experimental artifacts.

How can computational approaches enhance experimental design for M protein studies?

Computational approaches can significantly enhance experimental studies of M protein:

  • Epitope Prediction and Vaccine Design:

    • In silico prediction of B-cell and T-cell epitopes using tools like IEDB, VaxiJen, AllerTop, and ToxinPred

    • Machine learning tools can predict immunogenic epitopes within BCoV structural proteins

    • Computational vaccine candidate design combining epitopes with adjuvants and linkers

  • Structural Prediction and Analysis:

    • AlphaFold2 can predict tertiary structures of M protein constructs

    • Ramachandran plots and Z-scores help validate structural quality

    • Molecular dynamics simulations can predict the stability of engineered M protein variants

  • Protein-Protein Interaction Prediction:

    • Molecular docking using tools like Biovia Discovery Studio can predict interactions between M protein and binding partners

    • Binding energy calculations help prioritize experimental validation targets

    • The PDBSum computational tool can analyze amino acid interactions in complex structures

  • Immune Response Simulation:

    • C-ImmSim tool can predict immune responses to vaccine candidates

    • Simulation of primary and secondary immune responses against M protein-based vaccines

    • Prediction of cytokine production and immune cell activation patterns

  • Expression Optimization:

    • Codon optimization tools like Vector Builder improve expression in prokaryotic or eukaryotic systems

    • In silico cloning using Snap Gene to design expression vectors

    • Prediction of post-translational modifications using NetOGlyc and DictyOGlyc

Integrating these computational approaches with experimental work creates a powerful framework for M protein research, reducing the need for extensive trial-and-error experimentation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.