Recombinant Bovine CX3C chemokine receptor 1 (CX3CR1)

Shipped with Ice Packs
In Stock

Description

Structure and Classification

CX3CR1 belongs to the family of G protein-coupled receptors (GPCRs) and specifically functions as a receptor for fractalkine (CX3CL1). As a member of the Class A/1 Rhodopsin-like receptor family, bovine CX3CR1 shares structural similarities with other chemokine receptors . The receptor contains seven transmembrane domains characteristic of GPCRs and couples primarily with Gi proteins to mediate downstream signaling cascades.

While most structural studies have focused on human CX3CR1, the bovine homolog is believed to share significant structural features. Human CX3CR1-Gi1 complexes have been studied in both ligand-free and CX3CL1-bound states, revealing important insights into receptor activation mechanisms that likely apply to the bovine variant as well . These studies have demonstrated that CX3CR1 undergoes specific conformational changes upon ligand binding, particularly in the extracellular regions where the N-terminus moves closer to the center axis of the helical bundle .

Genetic Information and Homology

Bovine CX3CR1 shares considerable sequence homology with its human counterpart, which is also known by several synonyms including V28, CCRL1, GPR13, CMKDR1, and GPRV28 . This evolutionary conservation underscores the fundamental importance of this receptor across mammalian species. The genetic conservation of CX3CR1 between bovines and humans facilitates comparative studies that can inform both veterinary and human medical research.

Cholesterol Modulation in CX3CR1 Function

A notable feature of CX3CR1 activation is the role of cholesterol in modulating receptor function. Structural studies of human CX3CR1 have revealed that three cholesterol molecules play essential roles in conformation stabilization and signaling transduction . Unlike other Class A GPCRs that exhibit large outward movements of helix VI upon activation, CX3CR1 displays a more limited conformational change, which may be attributed to these cholesterol interactions . This mechanism is likely conserved in bovine CX3CR1 and represents an important consideration for studies utilizing recombinant forms of the protein.

Cellular Distribution in Bovine Tissues

CX3CR1 expression in bovine tissues follows cell type-specific patterns similar to those observed in other mammals. Research has demonstrated that bovine CX3CR1 is predominantly expressed on specific subsets of immune cells, with notable differences in expression levels that correlate with cellular function .

In bovine blood, CX3CR1 expression has been extensively studied on dendritic cells (DCs) and monocyte subsets. Flow cytometry analysis of peripheral blood mononuclear cells (PBMCs) has revealed distinct staining patterns when using recombinant CX3CL1 (the ligand for CX3CR1) to detect receptor expression . These patterns largely align with transcriptomic data from bulk RNA-sequencing of sorted DC and monocyte subsets .

Expression on Bovine Monocyte Subsets

CX3CR1 expression varies significantly across different monocyte populations in bovine blood. Research has established that CX3CR1 transcription allows for the distinction between nonclassical monocytes (ncM) and classical monocytes (cM) in cattle . Specifically, ncM display higher levels of CX3CL1 staining compared to cM, indicating greater CX3CR1 expression .

Interestingly, intermediate monocytes (intM) in bovine blood express the highest levels of CX3CR1 among all monocyte subsets, as confirmed by both transcriptomic analysis and CX3CL1 staining . This differential expression pattern suggests specialized roles for CX3CR1-expressing monocytes in bovine immune responses and potentially in inflammatory conditions.

The table below summarizes the relative expression patterns of CX3CR1 across different bovine immune cell populations:

Cell TypeCX3CR1 Expression LevelDetection Method
Intermediate Monocytes (intM)Very HighTranscriptomics, CX3CL1 staining
Nonclassical Monocytes (ncM)HighTranscriptomics, CX3CL1 staining
Classical Monocytes (cM)Low to ModerateTranscriptomics, CX3CL1 staining
Conventional DC1 (cDC1)ModerateCX3CL1 staining
Conventional DC2 (cDC2)ModerateCX3CL1 staining
Plasmacytoid DC (pDC)NegligibleCX3CL1 staining

Expression on Bovine Dendritic Cells

Among bovine dendritic cell subsets, both conventional DC1 (cDC1) and conventional DC2 (cDC2) show moderate CX3CR1 expression as evidenced by positive CX3CL1 staining in flow cytometry analyses . In contrast, plasmacytoid DCs (pDCs) show negligible CX3CR1 expression, consistent with transcriptomic data .

An interesting observation from recent research is the potential heterogeneity within the cDC2 population. In one study, an animal was found to contain two distinct subsets of cDC2 with differing CX3CR1 expression levels . This finding suggests greater complexity in the bovine DC compartment than previously recognized and highlights the need for further research using recombinant bovine CX3CR1 and its ligands.

Signaling Mechanisms

CX3CR1 functions primarily through G protein-coupled signaling pathways. Upon binding of CX3CL1, the receptor undergoes conformational changes that allow for interaction with Gi proteins, leading to inhibition of adenylyl cyclase and subsequent reduction in intracellular cAMP levels . Additionally, CX3CR1 activation triggers phospholipase C (PLC), phosphoinositide 3-kinase (PI3K), and extracellular signal-regulated kinase (ERK) pathways, ultimately influencing the activity of transcription factors such as NF-κB .

In human models, which likely mirror bovine mechanisms, CX3CR1 signaling involves a two-site binding model for CX3CL1 recognition. The globular part of CX3CL1 binds to the extracellular region of CX3CR1 (chemokine recognition site 1, CRS1), while the N-terminus of CX3CL1 adopts a hook-like conformation and inserts into the helical bundle of the receptor (CRS2) . This binding mechanism is likely conserved in bovine CX3CR1 and is crucial for proper receptor activation and function.

Role in Immune Cell Migration and Function

In bovines, as in other mammals, CX3CR1 plays a critical role in immune cell trafficking and function. The primary role of CX3CR1 in immune cells is to recognize CX3CL1 gradients and guide cells to enter inflamed tissues, thus initiating innate immune responses . This process is essential for the "patrolling" behavior of monocytes in blood vessels, which represents an initial step in host defense mechanisms .

The differential expression of CX3CR1 on distinct monocyte subsets in bovine blood suggests specialized functions for these cells. The high expression on nonclassical and intermediate monocytes indicates their enhanced ability to respond to CX3CL1 signals and potentially their greater involvement in surveillance and early inflammatory responses .

Tissue-Specific Functions

While research on tissue-specific functions of bovine CX3CR1 is less extensive than in human and mouse models, studies in other species provide insights into potential roles in bovine tissues. In mammals generally, CX3CR1 expression and function are highly tissue-specific .

In the central nervous system, CX3CR1 is primarily expressed on microglia, where it mediates interactions with neurons that express CX3CL1 . In the gut, CX3CR1 expression is restricted to macrophages, while in blood, it is found on monocytes . These tissue-specific expression patterns likely exist in bovine tissues as well and suggest distinct roles for CX3CR1-expressing cells in different anatomical locations.

Production Methods

Recombinant bovine CX3CR1 proteins are typically produced using various expression systems including bacterial (E. coli), mammalian cell lines (HEK293), and cell-free systems . Each production method offers specific advantages and limitations regarding protein folding, post-translational modifications, and functional activity.

The production of fully functional recombinant bovine CX3CR1 presents technical challenges due to its multi-transmembrane domain structure. Mammalian expression systems generally yield more native-like receptor conformations and are therefore often preferred for functional studies, while bacterial systems may be used for producing specific domains or peptide fragments for structural analyses or antibody production .

Purification and Tagging Strategies

Recombinant bovine CX3CR1 can be engineered with various tags to facilitate purification and detection. Common tags include histidine (His), glutathione S-transferase (GST), Avi, and Fc tags . These tags not only aid in purification through affinity chromatography but also assist in functional studies and binding assays.

The choice of tag and its position within the recombinant protein requires careful consideration, as it may influence receptor folding, ligand binding capacity, and signaling functionality. For studies focusing on ligand-receptor interactions, tag positioning should minimize interference with the binding domains identified in structural studies .

Research Applications

Recombinant bovine CX3CR1 serves multiple purposes in veterinary and comparative immunology research. Primary applications include:

  1. Structural and Functional Studies: Recombinant proteins facilitate investigations into receptor structure, ligand binding mechanisms, and signaling pathways .

  2. Antibody Production: Purified recombinant bovine CX3CR1 can be used to generate specific antibodies for detection and functional blocking studies.

  3. Flow Cytometry Reagents: Labeled recombinant CX3CR1 or its ligand CX3CL1 provide valuable tools for characterizing immune cell subsets in bovine samples .

  4. Drug Discovery: Recombinant proteins can be employed in screening assays to identify compounds that modulate CX3CR1 function, potentially leading to new veterinary therapeutics.

  5. Comparative Immunology: Studies comparing bovine CX3CR1 with its counterparts in other species contribute to our understanding of evolutionary conservation and species-specific adaptations in chemokine signaling systems.

Recent Findings in Bovine CX3CR1 Research

Recent research has focused on characterizing the expression patterns of CX3CR1 on bovine immune cell subsets and exploring its functional implications. Studies using multicolor flow cytometry with recombinant CX3CL1 have revealed distinct staining patterns that align with transcriptomic data, confirming differential expression across monocyte and dendritic cell populations .

Particularly noteworthy is the identification of potential heterogeneity within conventional DC2 populations, with some animals showing two distinct subsets differing in CX3CR1 expression . This finding suggests greater complexity in the bovine DC compartment than previously recognized and highlights the utility of recombinant proteins in distinguishing cellular subsets.

Research Gaps and Challenges

Despite progress in characterizing bovine CX3CR1, significant research gaps remain. These include:

  1. Structural Characterization: While structural information exists for human CX3CR1, detailed structural studies of bovine CX3CR1 are lacking. Such studies would inform species-specific differences in ligand recognition and signaling mechanisms.

  2. Tissue-Specific Functions: The roles of CX3CR1-expressing cells in different bovine tissues remain poorly understood, particularly in the context of health and disease.

  3. Species-Specific Ligand Interactions: The binding kinetics and specificity of bovine CX3CL1 to bovine CX3CR1 compared to cross-species interactions warrant further investigation.

  4. Functional Consequences of Expression Patterns: The functional implications of differential CX3CR1 expression across bovine monocyte and DC subsets require additional research.

Future Directions

Future research directions for recombinant bovine CX3CR1 include:

  1. Improved Production Methods: Development of more efficient expression systems for producing fully functional recombinant bovine CX3CR1 with native-like properties.

  2. Disease Associations: Investigation of CX3CR1 expression changes in bovine infectious and inflammatory diseases, potentially identifying biomarkers or therapeutic targets.

  3. Comparative Analyses: Expanded comparative studies between bovine, human, and other mammalian CX3CR1 to identify conserved and species-specific features.

  4. Therapeutic Applications: Exploration of CX3CR1 modulation as a potential therapeutic approach for bovine inflammatory and infectious diseases.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them when placing your order. We will accommodate your request as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are made with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
CX3CR1; CX3C chemokine receptor 1; C-X3-C CKR-1; CX3CR1; Fractalkine receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MHTTLPESTSENFEYYDLAEACDMGDIVALGTVFVVILYSLVFAFGLVGNLLVVFALINS QRSKSITDIYLLNLALSDLLFVATLPFWTHYVINEQGLHHATCKLITAFFFIGFFGGIFF ITVISVDRFLAIVLAANSMSNRTVQHGVTTSLGVWAAAILVATPQFMFTREKENECFGDY PEILQEIWPVILNTEINFLGFLLPLLIMSYCYFRIMQTLFSCKNHKKAKAIRLIFLVVVV FFLFWTPYNVMIFLQTLNLYDFFPKCDVKRDLKLAISVTETIAFSHCCLNPLIYAFAGEK FRRYLYRLYRKCLAVLCCHPDHLSFSSSLSESQRSRRESVLSSNFTHYTSDGDASILL
Uniprot No.

Target Background

Function
CX3CR1 is the receptor for the C-X3-C chemokine fractalkine (CX3CL1). It is expressed on various early leukocyte populations, including monocytes, macrophages, and natural killer (NK) cells. CX3CR1-CX3CL1 signaling plays diverse roles in different tissue compartments, impacting immune responses, inflammation, cell adhesion, and chemotaxis.
CX3CR1-CX3CL1 signaling regulates cell migratory functions. It facilitates the recruitment of NK cells to inflamed tissues. It acts as a regulator of inflammation in atherogenesis by mediating macrophage and monocyte recruitment to inflamed atherosclerotic plaques, thus promoting cell survival. In airway inflammation, it contributes by promoting the survival of interleukin 2-producing T helper (Th2) cells in inflamed lungs. It also plays a role in the migration of circulating monocytes to non-inflamed tissues, where they differentiate into macrophages and dendritic cells.
CX3CR1 acts as a negative regulator of angiogenesis, potentially by promoting macrophage chemotaxis. It is crucial in brain microglia by regulating inflammatory responses within the central nervous system (CNS) and influencing synapse maturation. CX3CR1 is necessary to restrain the microglial inflammatory response in the CNS and to minimize resulting parenchymal damage in response to pathological stimuli. It is involved in brain development by participating in synaptic pruning, a natural process where brain microglia eliminate excess synapses during postnatal development. Synaptic pruning by microglia is essential for promoting the maturation of circuit connectivity during brain development.
CX3CR1 is an important regulator of the gut microbiota by controlling immunity to intestinal bacteria and fungi. It is expressed in lamina propria dendritic cells in the small intestine, which form transepithelial dendrites capable of capturing bacteria to provide defense against pathogenic bacteria. CX3CR1 is required to initiate innate and adaptive immune responses against the dissemination of commensal fungi (mycobiota) that are part of the gut microbiome. It is expressed in mononuclear phagocytes (MNPs) and promotes the induction of antifungal IgG antibody responses, offering protection against disseminated infections by Candida albicans or Candida auris. CX3CR1 also acts as a receptor for the C-C motif chemokine CCL26, inducing cell chemotaxis.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and functional role of CX3CR1 in bovine systems?

CX3CR1 is a seven-transmembrane G protein-coupled receptor that functions as the specific receptor for CX3CL1 (fractalkine). The receptor consists of an extracellular N-terminus, seven transmembrane domains, three extracellular loops, three intracellular loops, and an intracellular C-terminus that couples to G proteins, particularly Gi or Gz proteins .

The CX3CR1-CX3CL1 signaling axis plays multiple crucial roles in bovine systems:

  • Mediates leukocyte adhesion and migration at the endothelium

  • Regulates immune cell recruitment during inflammation

  • Contributes to cell-cell interactions in various tissues

  • Participates in immune surveillance and homeostasis

These functions are accomplished through CX3CR1's ability to recognize both membrane-bound and soluble forms of CX3CL1, providing dual functionality in cell adhesion and chemotaxis .

Which bovine cell populations express CX3CR1 and how can this expression be reliably detected?

Based on comparative studies with other mammalian species, CX3CR1 expression in bovine systems is primarily found in:

  • Monocytes and specific macrophage subsets

  • Dendritic cells (DCs)

  • Microglia in the central nervous system

  • Subsets of T lymphocytes (particularly CD8+ T cells)

  • Natural killer (NK) cells

For reliable detection of bovine CX3CR1 expression, researchers should employ multiple complementary approaches:

Protein-level detection:

  • Flow cytometry using specific anti-bovine CX3CR1 antibodies

  • Immunohistochemistry for tissue localization

  • Western blotting for semi-quantitative analysis

mRNA-level detection:

  • RT-qPCR with bovine-specific primers

  • RNA in situ hybridization for tissue localization

  • RNA-Seq for comprehensive expression profiling

An innovative approach suggested by murine studies is the development of reporter systems where GFP replaces the CX3CR1 coding sequence, allowing direct visualization of expression patterns in transgenic animals or modified cell lines .

How does the binding specificity between bovine CX3CR1 and CX3CL1 compare to other species?

The CX3CR1-CX3CL1 interaction demonstrates high specificity across mammalian species, with the binding interface involving the N-terminal domain and extracellular loops of CX3CR1 and the chemokine domain of CX3CL1. While species-specific binding kinetics may vary, the core interaction is highly conserved.

Notable aspects of this interaction include:

  • The chemokine domain of CX3CL1 (amino acids 25-100) contains the principal binding determinants

  • The EC50 for chemotactic activity of rat CX3CL1 is 3-18 ng/mL, providing a reference point for expected potency in bovine systems

  • CX3CL1 can also interact with integrins (ITGAV:ITGB3 and ITGA4:ITGB1) in addition to CX3CR1, suggesting complex signaling networks

The high degree of sequence identity (83%) between rat, human, and mouse CX3CL1 (except in the stalk region) suggests similar conservation in the receptor-ligand interaction across species . Researchers working with bovine CX3CR1 should account for potential species-specific differences in binding affinity and signaling outcomes when translating findings from other mammalian models.

What are the standard methods for producing recombinant bovine CX3CR1 for research applications?

Production of functional recombinant bovine CX3CR1 requires careful consideration of expression systems and purification strategies. Based on approaches used for other G protein-coupled receptors, the following methods are recommended:

Expression systems:

  • Mammalian cell lines (HEK293, CHO) for proper folding and post-translational modifications

  • Insect cell systems (Sf9, High Five) for higher protein yields

  • Yeast systems (Pichia pastoris) as an alternative approach

Expression optimization strategies:

  • Codon optimization for the host system

  • Inclusion of affinity tags (His, FLAG) for purification and detection

  • Addition of signal sequences to enhance membrane targeting

  • Co-expression with G proteins to stabilize native conformation

  • Use of inducible expression systems to control expression levels

Purification considerations:

  • Selection of appropriate detergents for membrane protein solubilization

  • Step-wise purification approach combining affinity chromatography and size exclusion

  • Quality control by SDS-PAGE, Western blot, and functional binding assays

Researchers should validate the functionality of purified recombinant bovine CX3CR1 through binding assays with its ligand CX3CL1 and verification of downstream signaling activation.

How do inflammatory conditions affect CX3CR1 expression in bovine tissues?

Inflammatory stimuli significantly modulate the expression of both CX3CR1 and its ligand CX3CL1 in bovine tissues, creating a dynamic signaling environment. Based on comparative studies:

  • Pro-inflammatory cytokines (TNF-α, IL-1) and bacterial products (LPS) upregulate CX3CL1 expression in endothelial cells and other tissue-resident cells through NF-κB-dependent mechanisms

  • CX3CR1 expression on leukocytes may be differentially regulated during inflammation, with potential downregulation after receptor activation and internalization

  • Tissue-specific patterns of regulation may exist, with different kinetics in various organ systems

A study of glomerulonephritis demonstrated that CX3CL1 expression is induced on glomerular endothelium during inflammation, while CX3CR1 expression is identified on infiltrating T-cells and macrophages, which undergo chemotaxis toward CX3CL1 gradients . This suggests that the CX3CL1-CX3CR1 axis actively participates in leukocyte recruitment during inflammatory responses in bovine tissues.

Therapeutic interventions, such as steroid treatment, have been shown to decrease CX3CL1 expression in inflammatory conditions, suggesting that modulation of this pathway contributes to the resolution of inflammation .

What are the key signaling pathways activated by bovine CX3CR1 upon ligand binding?

CX3CR1 activation triggers multiple signaling cascades through both G protein-dependent and -independent mechanisms. The major signaling pathways include:

G protein-dependent pathways:

  • Activation of Gi/o proteins leading to inhibition of adenylyl cyclase and reduced cAMP levels

  • Release of Gβγ subunits activating phospholipase C and subsequent calcium mobilization

  • Activation of PI3K/Akt pathway promoting cell survival and polarization

  • Regulation of small GTPases (Rac, Rho, Cdc42) controlling cytoskeletal rearrangements

G protein-independent pathways:

  • Recruitment of β-arrestins leading to receptor internalization

  • Activation of MAP kinases (ERK1/2, p38, JNK) regulating gene expression

  • Potential transactivation of growth factor receptors

The CX3CR1-CX3CL1 signaling enhances monocyte binding to integrins and fibronectin, indicating significant cross-talk between chemokine receptor signaling and adhesion pathways . Additionally, CX3CL1 can activate integrins in both CX3CR1-dependent and CX3CR1-independent manners, suggesting complex signaling networks coordinating immune cell functions .

To comprehensively assess CX3CR1 signaling in bovine systems, researchers should employ:

  • Phosphorylation-specific antibodies for key signaling nodes

  • Real-time calcium imaging

  • G protein activation assays

  • Chemotaxis and adhesion functional readouts

  • Transcriptomic analysis of downstream gene expression changes

How can I assess the functional activity of recombinant bovine CX3CR1?

Comprehensive assessment of recombinant bovine CX3CR1 functionality requires multiple complementary approaches:

Ligand binding assays:

  • Competitive binding assays using labeled CX3CL1

  • Surface plasmon resonance to determine binding kinetics

  • BRET/FRET-based proximity assays

Signaling activation assays:

  • GTPγS binding to measure G protein activation

  • Calcium mobilization assays

  • ERK1/2 and Akt phosphorylation

  • cAMP inhibition assays (since CX3CR1 couples to Gi proteins)

Functional cellular assays:

Assay TypeMethodologyExpected ResultTypical EC50
ChemotaxisTranswell migration toward CX3CL1 gradientDose-dependent migration of CX3CR1+ cells3-18 ng/mL
AdhesionCell adhesion to immobilized CX3CL1Firm adhesion of CX3CR1+ cellsVaries by cell type
Cell signalingPhospho-flow cytometryIncreased phosphorylation of signaling proteins1-10 nM range

When interpreting results, researchers should consider that CX3CR1-mediated responses may vary depending on:

  • Cell type expressing the receptor

  • Presence of co-receptors or signaling modulators

  • Experimental conditions (temperature, pH, calcium concentration)

  • Form of CX3CL1 used (soluble chemokine domain vs. membrane-bound full-length)

What experimental models are available to study bovine CX3CR1 in inflammatory diseases?

Several experimental models can be employed to study bovine CX3CR1 in inflammatory diseases, each with specific advantages and limitations:

In vitro models:

  • Primary bovine immune cell cultures (monocytes, macrophages, dendritic cells)

  • Bovine endothelial cell lines expressing CX3CL1

  • Co-culture systems mimicking tissue-specific environments

  • Ex vivo tissue explants maintaining native cellular architecture

In vivo models:

  • LPS challenge models (systemic or localized) inducing CX3CL1 expression

  • Experimental infection models relevant to bovine diseases

  • Naturally occurring disease cases (mastitis, pneumonia, enteritis)

Genetic manipulation approaches:

  • CRISPR/Cas9-mediated knockout of CX3CR1 in bovine cell lines

  • Transgenic reporter systems similar to CX3CR1-GFP mice

  • RNA interference-based knockdown approaches

A particularly valuable approach derived from murine studies is the generation of reporter systems where GFP replaces the CX3CR1 coding sequence, allowing direct visualization and tracking of CX3CR1-expressing cells in different tissue contexts . This approach could be adapted to bovine systems using modern gene editing technologies.

Studies in rodent models demonstrate the value of CX3CR1 blockade in inflammatory conditions, with anti-CX3CR1 antibody treatment attenuating disease severity in glomerulonephritis . Similar approaches could be investigated in bovine inflammatory disease models.

How does glycosylation affect the function of bovine CX3CR1?

Glycosylation represents a critical post-translational modification affecting multiple aspects of CX3CR1 biology, although specific information on bovine CX3CR1 glycosylation is limited:

Functional impacts of glycosylation:

  • Cell surface expression and trafficking

  • Ligand binding affinity and specificity

  • Receptor stability and turnover rate

  • Protection against proteolytic degradation

  • Species-specific immune recognition

For bovine CX3CR1, researchers should investigate glycosylation through:

  • Identification of potential N-glycosylation sites (Asn-X-Ser/Thr motifs) in the bovine CX3CR1 sequence

  • Site-directed mutagenesis of predicted glycosylation sites

  • Expression in glycosylation-deficient cells or with glycosylation inhibitors

  • Enzymatic deglycosylation and functional assessment

  • Mass spectrometry characterization of glycan structures

Given that the binding between CX3CL1 and CX3CR1 involves the N-terminal domain of the receptor, glycosylation in this region could significantly impact ligand recognition and binding kinetics. Additionally, species-specific glycosylation patterns may contribute to differences in receptor function across mammalian species.

What approaches can be used to target the CX3CL1-CX3CR1 axis therapeutically in bovine diseases?

Therapeutic targeting of the CX3CL1-CX3CR1 axis represents a promising approach for treating inflammatory conditions in bovine species. Several potential strategies include:

Antibody-based approaches:

  • Neutralizing antibodies against bovine CX3CL1

  • Blocking antibodies targeting CX3CR1

  • Single-chain variable fragments (scFvs) with improved tissue penetration

Small molecule modulators:

  • CX3CR1 antagonists blocking ligand binding

  • Allosteric modulators altering receptor conformation

  • Signaling pathway inhibitors targeting downstream effectors

Biological modifiers:

  • Soluble CX3CR1 decoy receptors

  • Modified CX3CL1 analogues acting as antagonists

  • siRNA or antisense oligonucleotides targeting CX3CR1 expression

Evidence from rodent models supports the therapeutic potential of CX3CR1 blockade, with daily treatment using an anti-CX3CR1 antibody resulting in attenuated disease severity in glomerulonephritis . Additionally, competitive inhibition of CX3CL1 binding to immune cells using viral macrophage inflammatory protein-II (vMIP-II) attenuated disease in experimental glomerulonephritis .

Potential applications in bovine medicine include:

  • Management of excessive inflammation in mastitis

  • Treatment of inflammatory pulmonary conditions

  • Reduction of inflammatory damage in enteritis

  • Modulation of placental inflammation in reproductive disorders

When developing therapeutic approaches, researchers should consider tissue-specific targeting to avoid disrupting beneficial CX3CR1-mediated immune functions in unaffected tissues.

How can I establish a bovine CX3CR1 knockout model for functional studies?

Establishing bovine CX3CR1 knockout models has become increasingly feasible with advances in gene editing technologies. Several approaches are available with varying degrees of complexity and applicability:

Cell-based knockout models:

  • CRISPR/Cas9 editing of bovine macrophage or monocyte cell lines

  • Primary cell isolation followed by CRISPR/Cas9 ribonucleoprotein transfection

  • Lentiviral delivery of CRISPR components for stable integration

Animal-based approaches:

  • Somatic cell nuclear transfer using gene-edited fibroblasts

  • Direct embryo microinjection with CRISPR/Cas9 components

  • Base editing or prime editing for precise genetic modifications

The strategy employed for mouse CX3CR1 knockout models provides valuable guidance: replacement of the CX3CR1 coding sequence with a GFP-neo cassette, followed by removal of the neo gene using Cre recombinase . This approach generated viable homozygous knockout mice without developmental defects, suggesting it might be similarly effective in bovine systems .

Design considerations include:

  • Targeting early exons to ensure complete loss of function

  • Incorporating reporter genes (GFP, mCherry) for cell tracking

  • Including selection markers for efficient identification of edited cells

  • Using multiple guide RNAs to increase editing efficiency

The choice between complete knockout models versus reporter knock-in models depends on the specific research questions. Phenotypic characterization should include assessment of:

  • Immune cell development and distribution

  • Inflammatory responses to various stimuli

  • Susceptibility to infectious challenges

  • Tissue-specific alterations in homeostasis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.