Recombinant Bovine Cyclic nucleotide-gated cation channel alpha-3 (CNGA3)

Shipped with Ice Packs
In Stock

Description

Introduction

Cyclic nucleotide-gated (CNG) channels are essential for visual and olfactory transduction . These channels, crucial in sensory transduction, are tetrameric and composed of A and B subunits in their native forms . CNG channels are non-selective cation channels opened by direct binding of cyclic nucleotides, such as cGMP and cAMP . These channels are highly permeable to $$Na^+$$ and $$Ca^{2+}, and their activation can lead to depolarization and increases in internal \Ca^{2+}$$ concentrations, linking changes in cytoplasmic cyclic nucleotide levels to alterations in cellular excitability, neurotransmitter secretion, and stimulation of calcium-dependent pathways .

Variants and Their Impact

A comprehensive CNGA3 variant database combines all CNGA3 variants identified in an achromatopsia (ACHM) cohort with all CNGA3 sequence alterations obtained after an extensive literature search on PubMed, and database search in HGMD, LOVD, and ClinVar . This database comprises 316 variants, with four located in the alternate exon 3b and its flanking intronic sequences .

Systematic analysis of CNGA3 splice variants has identified different effects on splicing . A systematic functional analysis of 20 CNGA3 splice site variants detected in a large cohort of achromatopsia patients and/or listed in common variant databases was performed . All variants were analyzed by functional splice assays based on the pSPL3 exon trapping vector . Ten variants, both at canonical and non-canonical splice sites, induced aberrant splicing, including intronic nucleotide retention, exonic nucleotide deletion and exon skipping, resulting in 21 different aberrant transcripts . Eleven of these were predicted to introduce a premature termination codon .

Functional Analysis and Classification

Following the standards and guidelines of ACMG/AMP, 67 out of 316 sequence alterations were classified as variants of uncertain significance (VUS) . Furthermore, 12 out of 312 sequence alterations were classified as likely benign and 10 as benign . The 316 CNGA3 variants listed in the CNGA3 variant database were revised manually and expert‐categorized into “likely benign,” “VUS,” and “likely disease‐causing” applying specific criteria . Variants categorized as “likely benign” included variants classified as likely benign or benign according to ACMG/AMP guidelines, synonymous variants not predicted to affect splicing, missense variants with a minor allele frequency (MAF) higher than 0.1% and predicted to be tolerated by at least two in silico algorithms .

Tables

Splice Site PredictionsDescription
CanonicalVariants at canonical splice sites often lead to aberrant splicing, including exon skipping, intron retention, or activation of cryptic splice sites .
Non-CanonicalVariants at non-canonical splice sites can also disrupt normal splicing patterns, although the impact may be less predictable than that of canonical sites; these variants may lead to partial or subtle splicing defects .
Aberrant TranscriptsAberrant transcripts resulting from splice site mutations can introduce premature termination codons (PTCs), leading to non-sense mediated decay (NMD) or the production of truncated proteins; the impact on protein function depends on the location and nature of the disruption .
ACMG/AMP GuidelinesThese guidelines are used to classify variants based on the strength of evidence for pathogenicity; variants are categorized as pathogenic, likely pathogenic, uncertain significance (VUS), likely benign, or benign, based on criteria such as population frequency, functional studies, and co-segregation with disease .
MAFMinor allele frequency refers to the frequency of the less common allele in a population; variants with high MAFs are generally considered less likely to be pathogenic, especially if they are predicted to be tolerated by in silico tools .
In silico AlgorithmsThese are computational tools that predict the impact of a variant on protein function or splicing; algorithms consider factors such as evolutionary conservation, biophysical properties of amino acids, and the effect on splicing regulatory elements; predictions from multiple algorithms can provide more robust evidence for or against pathogenicity .
Exon 3b VariantsVariants located in the alternate exon 3b and its flanking intronic sequences have uncertain functional relevance and have not been associated with disease; these variants are often classified as likely benign due to the lack of evidence supporting their pathogenicity .
Missense SubstitutionsThese variants result in a change in the amino acid sequence of the protein; the impact on protein function depends on the location and properties of the substituted amino acid; variants affecting conserved residues or those with significant biophysical differences are more likely to be pathogenic .
Indel VariantsInsertion or deletion variants can cause frameshifts, leading to premature termination codons and truncated proteins; the impact on protein function depends on the size and location of the indel; indels that disrupt critical functional domains are more likely to be pathogenic .
Nonsense SubstitutionsThese variants introduce a premature stop codon, leading to truncated proteins; the impact on protein function depends on the location of the stop codon; nonsense variants that occur early in the protein sequence are more likely to result in a complete loss of function .
PIP3 and PIP2Phosphatidylinositol 3,4,5-triphosphate and Phosphatidylinositol 4,5-bisphosphate are signaling lipids that regulate various cellular processes, including ion channel function; PIP3 and PIP2 can bind to ion channels and modulate their activity, affecting channel gating and ligand sensitivity .
cAMP and cGMPCyclic adenosine monophosphate and cyclic guanosine monophosphate are cyclic nucleotides that act as intracellular second messengers; CNG channels are activated by direct binding of cAMP and cGMP, leading to channel opening and ion flux .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNGA3; CNCG3; Cyclic nucleotide-gated cation channel alpha-3; Cone photoreceptor cGMP-gated channel subunit alpha; Cyclic nucleotide-gated channel alpha-3; CNG channel alpha-3; CNG-3; CNG3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-706
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MAKISTQYSHPTRTHPSVRTMDRDLDCIENGLSRTHLPCEETSSELQEGIAMETRGLAES RQSSFTSQGPTRLSRLIISLRAWSARHLHQEDQRPDSFLERFRGAELQEVSSRESHVQFN VGSQEPPDRGRSAWPLARNNTNTCNNSEKDDKAKKEEKEKKEEKKENPKKEEKKKDSVVM DPSSNMYYHWLTVIAVPVFYNWCLLVCRACFDELQSEHLMLWLVLDYSADILYGMDMLVR ARTGFLEQGLMVMDASRLWKHYTQTLHFKLDVLSLVPTDLAYFKLGMNYPELRFNRLLKL ARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNVS NPEYGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGS MISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLP DKLKAEIAINVHLDTLRKVRIFQDCEAGLLVELVLKLRPAVFSPGDYICKKGDIGREMYI IKEGKLAVVAEDGITQFVVLGDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSK DDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAKAGADPKDIEEKVEHLETSLDSLQ TRFARLLAEYNATQMKVKQRLSQLESQVKMGLPPDGDAPQTEASQP
Uniprot No.

Target Background

Function
Visual signal transduction is mediated by a G-protein coupled cascade utilizing cGMP as a second messenger. This protein is activated by cyclic GMP, leading to cation channel opening and cone photoreceptor depolarization. It is crucial for generating light-evoked electrical responses in red, green, and blue-sensitive cones. Studies have shown it induces flickering channel gating, weakens outward rectification in the presence of extracellular calcium, increases sensitivity to L-cis diltiazem, and enhances cAMP efficacy when co-expressed with CNGB3. It may be responsible for cGMP-induced calcium entry in non-sensory cells and potentially involved in sperm chemotaxis.
Gene References Into Functions
  1. The S4 structural motif of CNGA3 is important for the cellular processing of cone photoreceptor cyclic GMP-gated ion channels. PMID: 15024024
Database Links
Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA3 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Testis, kidney, retinal cone and heart.

Q&A

What is the native subunit composition of CNG channels containing CNGA3?

The native CNG channel in olfactory sensory neurons (OSNs) is composed of three distinct subunits that coassemble to form a functional complex: CNCα3, CNCα4, and CNCβ1b. This has been established through comprehensive protein analysis and functional studies. Immunoprecipitation experiments under nondenaturing conditions demonstrate that antibodies against any of these three subunits can co-precipitate all three subunits, suggesting they form a single protein complex in the ciliary membrane .

To experimentally determine subunit composition:

  • Perform immunoprecipitation with subunit-specific antibodies

  • Conduct Western blot analysis of the precipitated complex

  • Express different subunit combinations in heterologous systems

  • Compare functional properties between native and reconstituted channels

How should researchers optimize detection of CNGA3 in tissue preparations?

CNGA3 detection requires careful sample preparation and consideration of post-translational modifications. In membrane preparations from olfactory epithelium, anti-CNCα3 antibodies typically recognize both a 75 kDa band and a diffuse "smear" at 110-145 kDa on Western blots . This characteristic pattern results from glycosylation of the native protein.

Methodological recommendations:

  • Include glycosidase treatment in parallel samples to confirm glycosylation

  • Prepare enriched ciliary membrane fractions to enhance detection

  • Use freshly prepared samples to minimize proteolytic degradation

  • Compare mobility with recombinant protein expressed in HEK 293 cells as a size standard

The glycosylation pattern significantly affects protein detection - treatment with glycosidase abolishes the diffuse smear signal entirely and enhances the 75 kDa band, confirming that the higher molecular weight signals represent glycosylated forms of CNGA3 .

What expression systems are most effective for functional studies of recombinant CNGA3?

Human embryonic kidney (HEK) 293 cells represent the gold standard expression system for functional studies of CNGA3. These cells provide several advantages:

  • Low endogenous channel expression

  • High transfection efficiency

  • Suitable membrane properties for electrophysiological recordings

  • Capability to express multiple channel subunits simultaneously

When expressing CNGA3-containing channels, it is critical to note that not all subunit combinations produce functional channels. Research demonstrates that CNCα3 alone, as well as the combinations CNCα3/CNCβ1b, CNCα3/CNCα4, and CNCα3/CNCα4/CNCβ1b produce functional channels, while expression of CNCα4 or CNCβ1b either alone or co-transfected does not yield functional CNG channels .

How can researchers quantitatively assess cyclic nucleotide sensitivity of CNGA3 channels?

Cyclic nucleotide sensitivity can be quantitatively assessed through patch-clamp electrophysiology in the inside-out configuration, which allows direct access to the intracellular domains of the channel. Key analytical parameters include:

Channel CompositionK₁/₂ for cAMP (μM)Hill Coefficient (n)
Native rat olfactory4.1Not specified
α3 aloneHigher than nativeNot specified
α3α4β1b4.8Similar to native
Other combinationsSignificantly higherVariable

Methodological approach:

  • Record macroscopic currents at different cAMP concentrations (typically 0.1-1000 μM)

  • Normalize current amplitudes to maximum response

  • Plot dose-response curves and fit with the Hill equation

  • Calculate K₁/₂ (concentration of half-maximal activation) and Hill coefficient (n)

The similarity in K₁/₂ values between native channels (4.1 μM) and heterologously expressed α3α4β1b channels (4.8 μM) confirms that all three subunits are necessary for the characteristic high cAMP sensitivity of native channels .

What methods are most effective for studying protein-protein interactions of CNGA3?

Multiple complementary approaches are required to rigorously establish and characterize CNGA3 protein-protein interactions:

  • Yeast two-hybrid screening: Initial identification of potential interaction partners

  • GST pulldown assays: Validation of direct protein interactions

    • Express GST-CNGA3 fusion proteins (typically the N-terminus)

    • Incubate with potential interaction partners

    • Capture complexes with glutathione-Sepharose beads

    • Analyze bound proteins by SDS-PAGE and immunoblotting

  • Surface plasmon resonance (SPR): Quantitative analysis of binding kinetics

    • Immobilize purified CNGA3 domains on sensor chips

    • Measure real-time binding of potential interaction partners

    • Determine association (ka) and dissociation (kd) rate constants

    • Calculate equilibrium dissociation constants (KD)

Using these methods, researchers have demonstrated that the amino terminus of CNGA3 specifically binds to the carboxyl terminus of cadherin 23 with expressed exon 68 (CDH23 +68) in a calcium-dependent manner .

How does calcium modulate CNGA3 interactions with binding partners?

Calcium concentration significantly impacts CNGA3 binding interactions with proteins like cadherin 23. SPR analysis reveals that CNGA3-N distinctly binds to CDH23 +68 in the presence of physiological calcium concentrations (26.5-68 μM Ca²⁺), while minimal or no binding occurs in calcium-depleted conditions .

To experimentally assess calcium dependency:

  • Perform binding assays in buffers with defined Ca²⁺ concentrations

  • Use SPR to measure association and dissociation kinetics under varying Ca²⁺ conditions

  • Compare binding parameters at different Ca²⁺ concentrations

  • Include calcium chelators (EGTA) as negative controls

The calcium dependence of these interactions suggests a potential regulatory mechanism where fluctuations in intracellular calcium concentration could modulate CNGA3 function through altered protein partnerships.

What evidence supports CNGA3 involvement in hair cell mechanotransduction?

Several lines of evidence point toward CNGA3 involvement in hair cell mechanotransduction:

  • CNGA3 is expressed in mammalian organ of Corti and saccular hair cells

  • CNGA3 interacts with stereocilia tip-link protein cadherin 23 +68 in a Ca²⁺-dependent manner

  • Myosin VIIa, a protein required for adaptation of hair cell mechanotransduction, competes with CDH23 +68 for binding to CNGA3

  • The specific interaction with CDH23 +68 (and not CDH23 -68) suggests a specialized role

This evidence has been established through multiple experimental approaches:

  • Pulldown assays showing that GST-CNGA3-N interacts with CDH23 +68 but not CDH23 -68

  • SPR analysis confirming calcium-dependent binding between CNGA3-N and CDH23 +68

  • Competition experiments demonstrating that myosin VIIa and CDH23 +68 compete for CNGA3 binding

How can Surface Plasmon Resonance (SPR) be optimized for studying CNGA3 interaction kinetics?

SPR provides quantitative binding parameters for CNGA3 interactions with binding partners. For optimal results:

  • Protein preparation:

    • Express and purify hexahistidine-tagged fusion proteins

    • Verify protein integrity by SDS-PAGE and Western blotting

    • Use affinity-purified proteins to minimize non-specific binding

  • Surface chemistry:

    • Immobilize ligand (e.g., CNGA3-N) on CM5 sensor chips via amine coupling

    • Prepare reference surfaces blocked with ethanolamine

    • Optimize immobilization density to prevent mass transport limitations

  • Experimental conditions:

    • Test analyte (e.g., CDH23 +68) at multiple concentrations (e.g., 0-320 nM)

    • Include calcium at physiologically relevant concentrations (e.g., 68 μM)

    • Regenerate chip surface between analyte injections with appropriate buffer

  • Data analysis:

    • Use appropriate binding models (e.g., 1:1 Langmuir binding model)

    • Determine association (ka) and dissociation (kd) rate constants

    • Calculate equilibrium dissociation constant (KD)

What are the key considerations when designing constructs for CNGA3 domain interaction studies?

Careful construct design is crucial for successful CNGA3 domain interaction studies:

  • Domain boundary definition:

    • For CNGA3 amino terminus, include residues covering the entire N-terminal region

    • For CDH23, define constructs with (+68) and without (-68) exon 68 (aa 3076-3353 and 3076-3317, respectively)

    • For myosin VIIa, include functional domains (SH3, MyTH4, and FERM domains, aa 1608-2177)

  • Expression vector selection:

    • Use pRSET vectors for hexahistidine-tagged proteins

    • Use pGEX vectors for GST fusion proteins

    • Include appropriate restriction sites for directional cloning

  • Purification strategy:

    • Design efficient purification protocols with affinity chromatography

    • Include protease inhibitors to prevent degradation

    • Verify protein purity and integrity by SDS-PAGE

  • Functional validation:

    • Confirm proper folding through functional assays

    • Test multiple construct designs if initial attempts fail

    • Consider codon optimization for the expression system used

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.