Recombinant Bovine Cysteine-rich with EGF-like domain protein 1 (CRELD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CRELD1; Protein disulfide isomerase CRELD1; Cysteine-rich with EGF-like domain protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-420
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
CRELD1
Target Protein Sequence
QISVPPQSSPHTEPHPCHTCRGLVDSFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETR LVEVLEGVCSKSDFECHRLLELSEELVESWWFHKQQEAPDLFQWLCSDSLKLCCPSGTFG PSCLPCPGGAERPCGGYGHCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHL VCSACFGPCARCSGPEESHCLQCKKGWALHHLKCVDIDECGTERASCGADQFCVNTEGSY ECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDECETAVCPGENQQCENTEGSYR CICADGYKQMEGICVKDQIPESAGFFSEMTEDELVVLQQMFFGVIICALATLAAKGDLVF TAIFIGAVAAMTGYWLSERSDRVLEGFIKGR
Uniprot No.

Target Background

Function
Protein disulfide isomerase; facilitates the trafficking of acetylcholine receptors (AChRs) to the cell membrane.
Database Links

KEGG: bta:504854

STRING: 9913.ENSBTAP00000014377

UniGene: Bt.5333

Protein Families
CRELD family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the structural characteristics of CRELD1 and other cysteine-rich EGF-like domain proteins?

Cysteine-rich EGF-like domain proteins, including CRELD1, are characterized by distinctive structural elements. These proteins typically contain two EGF-like Cysteine-rich domains (CRD1 and CRD2) connected by an intervening linker segment, often containing a SEA (Sea urchin, Enterokinase, Agrin) module . The cysteine spacing patterns in these domains are critical for proper protein folding and function, bearing structural similarities to epidermal growth factor (EGF) .

The characteristic cysteine residues form disulfide bonds that maintain the three-dimensional conformation of the protein. In related proteins like membrane-bound mucins MUC17 (human) and Muc3 (mouse), the extracellular regions demonstrate this bivalent display of CRDs, which appears essential for their biological activity .

How do recombinant CRELD family proteins function in cellular contexts?

Recombinant proteins from the CRELD family exhibit several important biological functions in cellular contexts. Based on studies of related proteins, they can:

  • Accelerate cell migration and wound healing processes

  • Inhibit cellular apoptosis (programmed cell death)

  • Provide cytoprotective effects

  • Potentially participate in cell signaling pathways

For instance, recombinant Muc3 CRD proteins have been shown to inhibit cellular apoptosis and accelerate cell migration over surfaces in vitro . Similarly, Creld2 has been identified as an important mediator in BMP9-initiated osteogenic signaling in mesenchymal stem cells, promoting osteogenic differentiation and matrix mineralization .

These proteins do not necessarily activate classical pathways (such as direct EGF receptor activation) but appear to function through alternative mechanisms that are still being elucidated .

What expression systems are suitable for producing recombinant CRELD family proteins?

Two primary expression systems have been successfully employed for producing recombinant cysteine-rich EGF-like domain proteins:

Expression SystemAdvantagesLimitationsExample Applications
E. coliHigher yield, cost-effective, easier scale-upMay lack post-translational modifications, potential for improper foldingProduction of Muc3-CRD1-L-CRD2, MUC17-CRD1-L-CRD2, NRG1-beta 1 EGF domain
Baculovirus-insect cell systemBetter post-translational modifications, improved folding capacityMore expensive, potentially lower yieldProduction of MUC17-CRD1-L-CRD2

Studies have demonstrated that some recombinant CRD proteins, such as MUC17-CRD1-L-CRD2, show similar biological activity whether produced in E. coli or baculovirus-insect cell systems . This suggests that for certain applications, the simpler E. coli system may be sufficient, especially when the protein's function does not depend heavily on eukaryotic-specific post-translational modifications.

How does the linker domain affect the biological activity of recombinant CRELD family proteins?

The intervening linker region between CRD domains plays a critical role in determining the biological activity of recombinant CRELD family proteins. Research on Muc3-CRD1-L-CRD2 has demonstrated that:

  • Full-length linker regions are required for optimal biological activity

  • Truncated linker regions result in diminished biological function

  • The linker region alone, without the flanking CRD domains, does not demonstrate biological activity

The SEA module within the linker segment may contribute to protein-protein interactions or proper spatial orientation of the CRD domains. In studies of Muc3-CRD1-L-CRD2, proteins with truncated linker regions failed to demonstrate cell migration or anti-apoptosis activity, highlighting the structural importance of this domain .

This suggests that when designing recombinant CRELD1 constructs, researchers should carefully consider the integrity of the linker region to maintain functional properties of the protein.

What are the key signaling pathways through which CRELD family proteins exert their biological effects?

While the specific mechanisms of action for CRELD1 remain under investigation, research on related family members provides insights into potential signaling pathways:

  • ER Stress Response Pathway: Creld2 has been identified as an ER stress-inducible factor localized in the ER-Golgi apparatus . Its expression is regulated by BMP9 through direct binding of Smad1/5/8 to the Creld2 promoter, suggesting a role in stress response signaling .

  • Indirect EGF Receptor Signaling: Unlike EGF itself, Muc3-CRD1-L-CRD2 does not directly activate EGF receptors but may function through alternative mechanisms to promote cell migration and inhibit apoptosis .

  • Osteogenic Differentiation Pathway: Creld2 potentiates BMP9-induced expression of early and late osteogenic markers and matrix mineralization in mesenchymal stem cells, indicating involvement in differentiation pathways .

Understanding these signaling mechanisms is crucial for developing therapeutic applications targeting CRELD family proteins or utilizing their recombinant forms as potential therapeutic agents.

How do post-translational modifications affect the function of recombinant CRELD family proteins?

Post-translational modifications (PTMs) may influence the function of CRELD family proteins, though research directly comparing modified versus unmodified forms is limited. Several considerations emerge from existing studies:

  • Disulfide Bond Formation: The proper formation of disulfide bonds between cysteine residues is essential for maintaining the structural integrity and functional activity of CRD domains.

  • Expression System Impact: Interestingly, studies comparing MUC17-CRD1-L-CRD2 produced in E. coli (which has limited capacity for eukaryotic PTMs) versus insect cell systems (with more elaborate PTM capabilities) found similar in vitro biological activity between the two versions . This suggests that for some functions, certain PTMs may not be essential.

  • Glycosylation: While not extensively studied in the provided research, glycosylation could potentially affect protein stability, half-life, and receptor interaction kinetics of CRELD family proteins.

Further comparative studies are needed to fully elucidate the role of specific PTMs in CRELD1 function and whether these modifications are necessary for particular applications or can be dispensed with for simplified production protocols.

What purification strategies are most effective for recombinant CRELD family proteins?

Effective purification of recombinant CRELD family proteins typically employs affinity chromatography approaches, with strategies varying based on the fusion tags incorporated:

  • GST-tagged proteins: For GST-fusion proteins (such as GST-Muc3-CRD1-L-CRD2), affinity chromatography using glutathione agarose provides an efficient single-step purification . The protein is expressed in E. coli by induction with isopropylthio-beta-D-galactoside (IPTG), then captured and purified on glutathione agarose columns.

  • His-tagged proteins: For His-tagged proteins, immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins allows for selective purification based on the high affinity of polyhistidine tags for metal ions. This approach is commonly used for proteins like His-tagged MUC17-CRD1-L-CRD2 .

  • Tag removal considerations: Depending on the experimental needs, proteolytic removal of fusion tags (using enzymes like thrombin or TEV protease) may be necessary to eliminate potential interference with biological activity, though research suggests that N-terminal GST or C-terminal His tags do not significantly affect the cell migration or anti-apoptosis activity of some CRD proteins .

After affinity purification, additional polishing steps such as size exclusion chromatography may be employed to achieve higher purity, especially for sensitive applications or structural studies.

What analytical methods are recommended for characterizing recombinant CRELD family proteins?

Comprehensive characterization of recombinant CRELD family proteins requires multiple analytical approaches:

  • SDS-PAGE and Immunoblotting: For assessing protein purity, molecular weight, and identity. Silver staining can be used for highly sensitive detection .

  • N-terminal Sequencing: Automated Edman degradation can confirm protein identity and integrity by determining the N-terminal amino acid sequence .

  • Mass Spectrometry: For accurate molecular weight determination and identification of post-translational modifications.

  • Circular Dichroism (CD) Spectroscopy: To evaluate secondary structure content and proper folding.

  • Functional Assays: Biological activity testing through:

    • Cell migration assays (wound healing)

    • Anti-apoptosis assays

    • Cell proliferation measurements

For example, the human NRG1-beta 1 EGF domain protein can be characterized by its ability to stimulate proliferation of MCF-7 human breast cancer cells with an ED50 of 0.06-0.3 ng/mL , while Muc3 CRD proteins can be evaluated through their effects on intestinal epithelial cell migration and protection from apoptosis .

How can researchers optimize the stability and storage conditions for recombinant CRELD family proteins?

Optimizing stability and storage conditions is crucial for maintaining the biological activity of recombinant CRELD family proteins:

Storage ParameterRecommended ApproachRationale
FormulationLyophilized from filtered solution (e.g., in acetonitrile and TFA)Provides long-term stability in dry state
Carrier proteinAddition of BSA (bovine serum albumin)Enhances protein stability, increases shelf-life, allows storage at more dilute concentrations
ReconstitutionIn sterile PBS at 100 μg/mLMaintains physiological conditions
Storage temperature-20°C to -80°CPrevents degradation; use manual defrost freezer
Freeze-thaw cyclesMinimize repeated cyclesPrevents denaturation and activity loss

For applications where the presence of carrier proteins might interfere (such as certain assays or crystallization studies), carrier-free formulations can be prepared, though these may have reduced stability .

Aliquoting the reconstituted protein into single-use volumes is recommended to avoid repeated freeze-thaw cycles, which can significantly reduce biological activity.

What are the best experimental designs for evaluating the biological activity of recombinant CRELD family proteins?

Robust experimental designs for evaluating the biological activity of recombinant CRELD family proteins should incorporate the following approaches:

  • Cell Line Selection:

    • Use responsive cell lines with known receptor expression profiles

    • Examples include:

      • LoVo cells (human colon cancer line expressing ErbB1 and low-level ErbB2 receptors)

      • IEC-6 cells (rat intestinal cell line)

      • YAMC cells (Young Adult Mouse Colon cell line)

      • MCF-7 cells (for EGF-like domain proteins)

  • Dose-Response Studies:

    • Establish ED50 values (effective dose for 50% response)

    • Test across wide concentration ranges (e.g., 0.01-100 ng/mL)

    • Include both positive controls (e.g., EGF) and negative controls

  • Functional Assays:

    • Cell Migration: Wound healing assays with time-lapse imaging

    • Anti-Apoptosis: Challenge with apoptosis inducers (e.g., TNF-α, staurosporine) followed by viability assessment

    • Osteogenic Differentiation: Alkaline phosphatase activity, Alizarin Red S staining for matrix mineralization

    • Cell Proliferation: BrdU incorporation or MTT assays

  • In Vivo Models:

    • Ectopic implantation assays for evaluating bone formation

    • Mouse models of inflammatory conditions (e.g., ulcerative colitis) for assessing healing properties

    • Include both gain-of-function (protein administration) and loss-of-function (silencing) approaches

Control experiments should include parallel testing of tagged versus untagged proteins, full-length versus truncated variants, and comparison of proteins produced in different expression systems to evaluate the impact of these factors on biological activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.