Recombinant Bovine Cytochrome b ascorbate-dependent protein 3 (CYBASC3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, centrifuge the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein. Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CYB561A3; Lysosomal membrane ascorbate-dependent ferrireductase CYB561A3; Cytochrome b ascorbate-dependent protein 3; Lysosomal cytochrome b; LCytb
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
CYB561A3
Target Protein Sequence
MAVGWFYLSVLALCSLGSMCILFTIYWMRYWHGGFAWDGSMLMFNWHPVLMVTGMVVLYS AASLVYRLPQSWVGPRLPWKSGHAAMHLLAFLLTVLGLHAVFEFHNHAKIPHLYSLHSWL GITTVFLFACQWFLGFSVFLLPWASMWLRSLLKPIHVFFGASILSLAIASVVSGINEKLF FSLKNGTKTYSNLPSEAVFANCAGMLVVVFGLLVLYILLASSWKRPEPGMQAEREPTRTR GRAGTPEVMLEGERGLAEPLLQKRS
Uniprot No.

Target Background

Function
Cytochrome b ascorbate-dependent protein 3 (CYBASC3) is a transmembrane reductase that utilizes ascorbate as an electron donor in the cytoplasm. It facilitates electron transfer across membranes to reduce iron cations Fe(3+) to Fe(2+) within the lumen of the late endosome and lysosome. Reduced iron can then be exported from these compartments to the cytoplasm via divalent metal-specific transporters. Therefore, CYBASC3 is likely involved in regulating iron homeostasis within endosomes and lysosomes.
Database Links
Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b ascorbate-dependent protein 3 and what is its primary function?

Cytochrome b ascorbate-dependent protein 3 (gene name: CYBASC3 or CYB561A3) is a transmembrane hemoprotein containing one cytochrome b561 domain. It functions primarily as a ferric-chelate reductase that catalyzes the reduction of Fe³⁺ to Fe²⁺ before iron transport from the endosome to the cytoplasm. This protein likely uses ascorbate as its electron donor for this redox function .

The protein belongs to the cytochrome b561 family, a group of transmembrane proteins specific to catecholamine and neuropeptide secretory vesicles found in neuroendocrine tissues including the adrenal medulla and pituitary gland. These 30-kD cytochromes are present in both small synaptic vesicles and large dense core vesicles (chromaffin granules), supplying reducing equivalents to monooxygenases such as dopamine beta-hydroxylase in chromaffin granules and peptidylglycine alpha-amidating monooxygenase in neurosecretory vesicles .

How conserved is Cytochrome b ascorbate-dependent protein 3 across species?

Cytochrome b ascorbate-dependent protein 3 demonstrates considerable conservation across mammalian species. The gene (CYB561A3) has been identified and characterized in multiple organisms including Homo sapiens (Human), Mus musculus (Mouse), Rattus norvegicus (Rat), and Bos taurus (Cow) . This cross-species conservation suggests the evolutionary importance of this protein's function in iron metabolism and redox processes.

In bovine species specifically, the protein is officially referred to as "cytochrome b, ascorbate dependent 3" in nomenclature databases, while in other mammals such as humans, mice, and rats, it is classified as "cytochrome b561 family, member A3" . This conservation facilitates comparative studies and allows researchers to develop hypotheses about structure-function relationships based on findings across different model organisms.

What expression systems are most effective for producing recombinant Cytochrome b ascorbate-dependent protein 3?

While the search results don't specifically address expression systems for bovine Cytochrome b ascorbate-dependent protein 3, insights can be drawn from related cytochrome expression systems. For cytochromes of this family, bacterial expression systems have been optimized to produce high yields of functional protein. Specifically, using Escherichia coli Rosetta-gami B(DE3) strain has proven effective for expressing related cytochromes with yields of approximately 26 mg of purified, ascorbate-reducible cytochrome per liter of culture .

The effectiveness of this expression system derives from its ability to address several challenges inherent in recombinant cytochrome production:

  • Codon bias issues

  • Disulfide bond formation

  • Target plasmid stability

Key optimization strategies for maximizing yield include:

  • Low-temperature induction (20°C)

  • Media supplementation with heme and δ-aminolevulinic acid

  • Appropriate detergent selection for extraction (n-dodecyl-β-D-maltoside has proven effective)

  • Utilization of cobalt ion affinity chromatography for purification

This represents a substantial improvement (approximately 7-fold) over insect cell-based expression systems previously used for similar cytochromes, making it particularly suitable for producing quantities needed for biochemical, biophysical, and structural studies .

What purification methods yield the highest purity and activity for recombinant Cytochrome b ascorbate-dependent protein 3?

Based on successful approaches with related cytochromes, a recommended purification protocol would involve:

  • Solubilization of the membrane fraction containing the recombinant protein using n-dodecyl-β-D-maltoside (DM), which has been identified as suitable for efficient extraction while maintaining protein activity

  • Affinity chromatography using cobalt resin, taking advantage of His-tagged constructs

  • Ensuring maintenance of reducing conditions throughout purification to preserve heme centers

This approach has yielded electrophoretically homogeneous protein with typical yields of 26.4 mg of purified, ascorbate-reducible cytochrome per liter of bacterial culture for related proteins . Importantly, the purified protein using these methods retains functional reactivity with ascorbate, as determined by spectroscopic and kinetic measurements, and achieves a heme-to-protein ratio very close to the theoretical value of two for cytochromes of this family .

How can researchers effectively characterize the redox properties of Cytochrome b ascorbate-dependent protein 3?

Several complementary approaches can be employed to characterize the redox properties of Cytochrome b ascorbate-dependent protein 3:

  • Spectroscopic Analysis: UV-visible spectroscopy to monitor changes in the alpha band (~560 nm) during reduction by ascorbate. This technique can identify different heme centers based on their reduction profiles.

  • EPR Spectroscopy: For pre-oxidized cytochrome, characteristic low-spin ferric heme signals at specific g-values can be observed. For related cytochromes, signals at g₁=3.72 (corresponding to low-potential heme center) and g₂=3.23 and g₃=2.25 (from high-potential heme center) have been documented . Changes in these signals upon addition of reductants like ascorbate provide valuable information about the redox behavior of individual heme centers.

  • Ascorbate Titration: Titration with increasing concentrations of ascorbate while monitoring absorbance changes can reveal the presence of multiple heme centers with different redox potentials. For related cytochromes, this has identified:

    • High-potential heme center (b₍H₎) with midpoint ascorbate concentration of ~3.0 μM

    • Low-potential heme center (b₍L₎) with midpoint ascorbate concentration of ~123 μM

    • Very low-potential heme species (potentially non-native) requiring much higher ascorbate concentrations (~11 mM)

  • Stopped-flow Kinetic Analysis: This technique allows for examination of the rate of reduction by ascorbate and can distinguish between different kinetic phases corresponding to different heme centers.

What spectroscopic signatures are characteristic of properly folded Cytochrome b ascorbate-dependent protein 3?

Properly folded Cytochrome b ascorbate-dependent protein 3 exhibits several characteristic spectroscopic features that researchers can use to verify protein quality:

  • UV-visible Spectroscopy:

    • Oxidized form: Soret band (typically ~410-415 nm) and weaker bands in the visible region

    • Reduced form: Shifted Soret band and sharper alpha (~560 nm) and beta bands

    • A clear spectral change upon addition of ascorbate indicates functional heme centers

  • EPR Spectroscopy:

    • Low-spin ferric heme signals indicating bis-His coordination (typically g₍z₎=3.7-3.2)

    • HALS (highly axial low spin) type signals representing distinct heme centers

    • Minimal signals at g=4.3 and 2.0 (characteristic of non-specifically bound "adventitious" ferric iron)

  • Heme:Protein Ratio:

    • A ratio approaching the theoretical value of 2:1 (for cytochromes with two heme centers)

    • Substantially lower ratios may indicate improper folding or heme incorporation

The presence of aberrant spectroscopic features, such as increased intensity at g=2.98 in EPR after treatment with high concentrations of oxidants like ferricyanide, can indicate disruption of the native heme centers and should be monitored as a quality control parameter .

How does the kinetic selectivity of ascorbate for different heme centers in Cytochrome b ascorbate-dependent protein 3 influence its physiological function?

Research with related cytochromes has revealed a marked kinetic selectivity of ascorbate for the high-potential heme center over the low-potential heme center . This differential reactivity likely has significant implications for the protein's physiological function in iron metabolism.

The observed selectivity suggests a sequential electron transfer mechanism:

  • Ascorbate initially reduces the high-potential heme center (b₍H₎)

  • Electrons are then transferred internally to the low-potential heme center (b₍L₎)

  • The reduced low-potential heme can then donate electrons to Fe³⁺, reducing it to Fe²⁺

This arrangement would allow the protein to efficiently couple the oxidation of cytosolic ascorbate to the reduction of endosomal/vesicular Fe³⁺, facilitating iron transport across membranes. The different redox potentials of the two heme centers create an electron transfer gradient that drives the process in one direction.

Understanding this selectivity is crucial for researchers investigating:

  • The protein's role in iron homeostasis

  • Potential dysfunction in iron metabolism disorders

  • Structure-function relationships in cytochrome b561 family proteins

  • Development of potential therapeutic approaches targeting iron metabolism

What structural features determine substrate specificity in Cytochrome b ascorbate-dependent protein 3?

While the available search results don't provide specific structural information about substrate specificity determinants in bovine Cytochrome b ascorbate-dependent protein 3, several structural features likely influence its specificity based on knowledge of related cytochromes:

  • Transmembrane Helices: The arrangement of transmembrane helices creates a specific environment for heme coordination and substrate binding.

  • Heme Coordination: Bis-histidine coordination of heme centers affects their redox potentials and reactivity with substrates.

  • Binding Sites for Ascorbate: Specific amino acid residues likely create binding pockets that recognize ascorbate, with charged and polar residues facilitating interaction with this substrate.

  • Access Channels: The protein structure likely includes channels that allow substrate access to heme centers from opposite sides of the membrane, enabling transmembrane electron transfer.

  • Fe³⁺ Binding Sites: Structural features that facilitate interaction with ferric iron would be essential for the protein's function as a ferric-chelate reductase.

Advanced research on this topic would benefit from techniques such as:

  • X-ray crystallography or cryo-EM to determine high-resolution structures

  • Site-directed mutagenesis to identify critical residues for substrate interaction

  • Computational modeling to predict substrate binding and electron transfer pathways

  • Hydrogen-deuterium exchange mass spectrometry to identify regions with substrate-induced conformational changes

What are the critical controls needed when assessing the ferric-chelate reductase activity of Cytochrome b ascorbate-dependent protein 3?

When designing experiments to assess the ferric-chelate reductase activity of Cytochrome b ascorbate-dependent protein 3, several critical controls should be included:

  • Enzyme-free Control: To account for non-enzymatic reduction of Fe³⁺ by ascorbate alone.

  • Heat-inactivated Enzyme Control: To verify that observed activity is protein-dependent and not due to co-purified factors.

  • Ascorbate-free Control: To confirm the requirement for ascorbate as an electron donor.

  • Alternative Metal Ion Controls: Testing with metals other than iron (e.g., Cu²⁺) to assess substrate specificity.

  • pH Dependence Controls: Assessing activity across a pH range to identify optimal conditions and physiological relevance.

  • Inhibitor Controls: Using known inhibitors of related cytochromes to confirm specificity of the assay.

  • Redox-inactive Mutant Control: If available, a mutant with altered heme coordination or binding should show reduced or abolished activity.

These controls help distinguish specific enzymatic activity from non-specific effects and provide confidence in experimental results when characterizing this protein's function as a ferric-chelate reductase.

How should researchers address potential artifacts in spectroscopic analysis of Cytochrome b ascorbate-dependent protein 3?

Spectroscopic analysis of Cytochrome b ascorbate-dependent protein 3 can be subject to several artifacts that researchers should systematically address:

  • Non-specific Heme Binding:

    • Artifact: Loosely associated heme that is not properly incorporated into the protein

    • Solution: Extensive washing during purification; comparison of heme:protein stoichiometry to theoretical values

  • Oxidative Damage During Purification:

    • Artifact: Formation of non-native very low-potential heme species

    • Solution: Inclusion of reducing agents during purification; careful control of oxidant concentrations during experiments

  • Detergent Interference:

    • Artifact: Changes in spectral properties due to detergent effects on protein structure

    • Solution: Control experiments with detergent alone; comparison across different detergent types

  • Light Sensitivity:

    • Artifact: Photobleaching or photoreduction during spectroscopic measurements

    • Solution: Minimize light exposure; use fresh samples for each measurement

  • Buffer Components:

    • Artifact: Interference from buffer components that can act as weak reductants or oxidants

    • Solution: Careful buffer selection; control experiments with different buffer systems

  • Sample Heterogeneity:

    • Artifact: Mixed populations of native and partially denatured protein

    • Solution: Size-exclusion chromatography prior to analysis; monitoring multiple spectroscopic parameters

By systematically addressing these potential artifacts, researchers can increase confidence in their spectroscopic characterization of this cytochrome and avoid misinterpretation of experimental results.

How does bovine Cytochrome b ascorbate-dependent protein 3 compare functionally to its homologs in other species?

While the available search results don't provide direct comparative data for bovine Cytochrome b ascorbate-dependent protein 3 versus other species, several general points can be considered for researchers conducting comparative studies:

  • Sequence Conservation: The classification of this protein across species suggests functional conservation, with the bovine protein specifically designated as "cytochrome b, ascorbate dependent 3" while human, mouse, and rat homologs are classified as "cytochrome b561 family, member A3" .

  • Tissue Distribution: Researchers should investigate whether the tissue-specific expression patterns observed in humans (adrenal medulla, pituitary gland, and other neuroendocrine tissues) are conserved in bovine systems or if there are species-specific differences.

  • Kinetic Parameters: Comparison of kinetic parameters (Km, Vmax) for ascorbate utilization and ferric iron reduction across species can reveal subtle functional adaptations.

  • Regulatory Mechanisms: Investigation of whether transcriptional and post-translational regulation of the protein differs between bovine and other mammalian systems.

Comparative studies across species can provide valuable insights into:

  • Evolutionarily conserved functional domains

  • Species-specific adaptations in iron metabolism

  • Translation of findings from model organisms to bovine systems

  • Identification of critical residues through correlation of sequence variations with functional differences

What evolutionary insights can be gained from studying Cytochrome b ascorbate-dependent protein 3 across different species?

Evolutionary analysis of Cytochrome b ascorbate-dependent protein 3 across species can provide significant insights for researchers:

  • Conservation of Iron Metabolism: The presence of this protein across mammals suggests the fundamental importance of its role in iron homeostasis throughout mammalian evolution.

  • Adaptations to Dietary Iron Availability: Species-specific variations might reflect adaptations to different dietary iron sources and availability, particularly relevant for comparing ruminants like cattle to other mammals.

  • Co-evolution with Other Iron Transport Proteins: Analysis of evolutionary patterns alongside other proteins involved in iron metabolism (transporters, storage proteins, etc.) can reveal co-evolutionary relationships.

  • Structural Conservation vs. Variation: Mapping sequence conservation onto structural models can identify:

    • Highly conserved regions critical for function (likely heme binding sites and catalytic residues)

    • Variable regions that might confer species-specific properties or interactions

  • Genomic Context: Analysis of genomic organization across species can provide insights into regulatory evolution and potential gene duplication events within the cytochrome b561 family.

This evolutionary perspective can inform experimental design, help interpret experimental results in a broader biological context, and potentially identify bovine-specific features relevant to agricultural and veterinary applications.

How can researchers overcome low expression yields when producing recombinant Cytochrome b ascorbate-dependent protein 3?

Based on experiences with related cytochromes, researchers facing low expression yields of recombinant Cytochrome b ascorbate-dependent protein 3 can implement several strategies:

  • Optimize Expression System:

    • Consider switching to Escherichia coli Rosetta-gami B(DE3) strain, which addresses issues with codon bias, disulfide bond formation, and plasmid stability

    • This approach has shown dramatic improvements (7-fold) over insect cell expression systems for related cytochromes

  • Optimize Induction Conditions:

    • Lower induction temperature (e.g., 20°C) to slow protein production and improve folding

    • Test different inducer concentrations and induction times

    • Consider auto-induction media for gentler protein expression

  • Enhance Heme Incorporation:

    • Supplement growth media with heme and δ-aminolevulinic acid to ensure adequate heme availability

    • Optimize timing of heme supplementation relative to induction

  • Codon Optimization:

    • Use codon-optimized synthetic genes adapted for the expression host

    • Particularly important for bovine sequences expressed in microbial systems

  • Fusion Tags:

    • Test different solubility-enhancing fusion partners (e.g., SUMO, MBP, TrxA)

    • Carefully position His-tags to minimize interference with folding

  • Scale-up Strategies:

    • Implement fed-batch cultivation to achieve higher cell densities

    • Optimize media composition to support high-density growth

The combination of these approaches can potentially increase yields to levels suitable for structural and biophysical studies (>25 mg/L of culture) .

What strategies can address stability issues during purification of Cytochrome b ascorbate-dependent protein 3?

Membrane proteins like Cytochrome b ascorbate-dependent protein 3 often present stability challenges during purification. Based on experiences with related cytochromes, researchers can implement these strategies:

  • Optimal Detergent Selection:

    • n-Dodecyl-β-D-maltoside (DM) has proven effective for related cytochromes

    • Consider screening a panel of detergents including DDM, LMNG, and GDN

    • Evaluate detergent efficiency for both extraction yield and protein stability

  • Buffer Optimization:

    • Include glycerol (10-20%) to enhance stability

    • Test different pH conditions to find stability optima

    • Include stabilizing additives like cholesterol hemisuccinate for membrane proteins

  • Redox Environment Control:

    • Maintain reducing conditions with agents like DTT or β-mercaptoethanol to protect heme centers

    • Avoid excessive concentrations of oxidants like ferricyanide which can disrupt heme centers

    • Consider anaerobic purification for particularly sensitive preparations

  • Temperature Management:

    • Perform all purification steps at 4°C

    • Minimize freeze-thaw cycles which can destabilize membrane proteins

    • Validate storage conditions (buffer composition, temperature) for long-term stability

  • Chromatography Considerations:

    • Optimize imidazole concentrations in His-tag affinity chromatography to balance purity and yield

    • Consider cobalt resin instead of nickel for gentler elution conditions

    • Implement size exclusion chromatography as a final polishing step to remove aggregates

  • Rapid Processing:

    • Minimize time between steps to reduce exposure to potentially destabilizing conditions

    • Consider continuous purification approaches where feasible

By systematically optimizing these parameters, researchers can significantly improve the stability and homogeneity of purified Cytochrome b ascorbate-dependent protein 3 preparations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.