Recombinant Bovine Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid form has a 6-month shelf life at -20°C/-80°C, while lyophilized form has a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
UQCRFS1; Cytochrome b-c1 complex subunit Rieske, mitochondrial; Complex III subunit 5; Cytochrome b-c1 complex subunit 5; Rieske iron-sulfur protein; RISP; Rieske protein UQCRFS1; Ubiquinol-cytochrome c reductase iron-sulfur subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
79-274
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVS SMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDP QHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNL EVPSYEFTSDDMVIVG
Uniprot No.

Target Background

Function
Recombinant Bovine Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1), is a component of ubiquinol-cytochrome c oxidoreductase (complex III, CIII), a multisubunit transmembrane complex within the mitochondrial electron transport chain (ETC). The ETC drives oxidative phosphorylation, a process involving three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes collaboratively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that powers transmembrane transport and ATP synthase. Complex III catalyzes electron transfer from ubiquinol to cytochrome c, coupling this redox reaction to proton translocation across the inner mitochondrial membrane via the Q cycle. This cycle consumes 2 protons from the matrix, releases 4 protons into the intermembrane space, and transfers 2 electrons to cytochrome c. The Rieske iron-sulfur protein is a catalytic core subunit of complex III. UQCRFS1 undergoes proteolytic processing after integration into the complex III dimer, yielding a fragment (subunit 9) corresponding to its mitochondrial targeting sequence (MTS). This processing is crucial for correct insertion into the complex III dimer; however, the persistence of UQCRFS1-derived fragments can hinder the processing and assembly of newly imported UQCRFS1, impairing complex III structure and function.
Gene References Into Functions
  1. This study provides the first direct evidence that histidine serves as the redox-linked protonation site in the Rieske iron-sulfur protein subunit of cytochrome bc1. PMID: 15766251
  2. Three hydrogen-bond mutant Rieske clusters exhibited decreased reduction potentials and increased pK values, consistent with the disruption of a hydrogen-bonding dipole that stabilizes the most negatively charged state. PMID: 15865449
  3. In the bc(1) complex's catalytic cycle, the [2Fe-2S] cluster may function as a proton exit gate. PMID: 15878858
Database Links

KEGG: bta:287020

UniGene: Bt.265

Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and primary function of UQCRFS1 in the mitochondrial respiratory chain?

UQCRFS1 is a nuclear-encoded subunit of respiratory chain protein Ubiquinol Cytochrome c Reductase (Complex III or Cytochrome bc1 complex). The human UQCRFS1 gene produces a 29.7 kDa protein composed of 274 amino acids with a distinctive 78 amino acid N-terminal extension sequence . As a catalytic subunit, UQCRFS1 contains a high-potential 2Fe-2S cluster essential for electron transfer within the complex .

Methodologically, structural analysis of UQCRFS1 typically involves X-ray crystallography or cryo-electron microscopy of the intact Complex III. Functional studies require intact mitochondrial preparations or reconstituted proteoliposomes containing purified Complex III components. The protein participates in the catalytic reaction: QH2 + 2 ferricytochrome c = Q + 2 ferrocytochrome c + 2 H+, which is central to the electron transport chain and oxidative phosphorylation .

How do mutations in UQCRFS1 affect Complex III assembly and function?

Pathogenic variants in UQCRFS1 significantly impair Complex III assembly and function. Studies in patient-derived fibroblasts have demonstrated that UQCRFS1 mutations can lead to:

  • Reduced UQCRFS1 protein abundance

  • Impaired mitochondrial import of the protein

  • Defective Complex III assembly

  • Compromised cellular respiration

Research approaches to study these effects typically involve site-directed mutagenesis of conserved residues, followed by expression in appropriate cell models. Complementation studies using lentiviral transduction to express wild-type UQCRFS1 in affected cells have successfully restored mitochondrial function, confirming the causative relationship between UQCRFS1 variants and Complex III deficiency .

What experimental approaches are most effective for studying UQCRFS1 interactions with other Complex III components?

Investigating UQCRFS1 interactions with other Complex III components requires sophisticated biochemical and biophysical techniques:

  • Co-immunoprecipitation with antibodies against UQCRFS1 or other Complex III subunits

  • Blue Native-PAGE to analyze intact Complex III assembly

  • Cross-linking mass spectrometry to identify interaction interfaces

  • Yeast two-hybrid or mammalian two-hybrid assays for specific binary interactions

  • Proximity labeling approaches (BioID, APEX) to map the protein interaction neighborhood

When designing these experiments, researchers should consider that Complex III exists as a symmetric homodimer composed of one mitochondrially encoded cytochrome b subunit and ten nucleus-encoded subunits, including UQCRFS1 . The bc1 complex's quaternary structure influences these interactions, which must be accounted for in experimental design.

What are optimal approaches for producing recombinant UQCRFS1 protein for structural and functional studies?

Production of functional recombinant UQCRFS1 presents significant challenges due to its iron-sulfur cluster and membrane association. Effective approaches include:

  • Bacterial expression systems:

    • Use E. coli strains engineered for iron-sulfur protein expression (e.g., SHuffle, OrigamiB)

    • Co-express bacterial iron-sulfur cluster assembly machinery

    • Include solubility tags (MBP, SUMO, TrxA) to improve folding

  • Eukaryotic expression systems:

    • Baculovirus-insect cell expression for improved post-translational modifications

    • Mammalian cell expression when authentic folding and processing are required

  • Cell-free systems supplemented with chaperones and iron-sulfur cluster assembly components

Purification protocols typically involve:

  • Initial extraction with mild detergents (DDM, LMNG)

  • Immobilized metal affinity chromatography

  • Size exclusion chromatography under conditions that maintain the iron-sulfur cluster integrity

Special considerations should include anaerobic conditions during purification to protect the iron-sulfur cluster and spectroscopic validation of cluster incorporation (EPR, UV-visible absorption spectroscopy).

How can researchers effectively knockdown or knockout UQCRFS1 to study its function?

UQCRFS1 knockdown/knockout studies provide valuable insights into protein function. Based on published methodologies:

  • siRNA transfection:

    • Successfully demonstrated in ovarian cancer cell lines (A2780, OVCAR8)

    • Resulted in significantly reduced cell proliferation

    • Induced G1 phase cell cycle arrest

    • Increased apoptosis and ROS production

  • CRISPR-Cas9 genome editing:

    • Target conserved exonic regions avoiding splice sites

    • Consider inducible systems since complete knockout may be lethal

    • Validate editing by sequencing and protein expression analysis

  • Experimental validation:

    • Western blot to confirm protein reduction

    • Blue Native-PAGE to assess Complex III assembly

    • Oxygen consumption measurements to evaluate respiratory function

    • Cell viability assays to determine phenotypic consequences

When interpreting results, researchers should consider that UQCRFS1 knockdown affects multiple cellular pathways including cell cycle progression, apoptosis, oxidative phosphorylation, and DNA damage response pathways .

What techniques are most reliable for measuring UQCRFS1-dependent enzymatic activity?

Accurate assessment of UQCRFS1-dependent enzymatic activity requires:

  • Spectrophotometric assays:

    • Monitoring cytochrome c reduction at 550 nm

    • Using decylubiquinol as electron donor

    • Including appropriate inhibitors (antimycin A, myxothiazol) as controls

  • Polarographic measurements:

    • Oxygen consumption using Clark-type electrodes

    • Substrate-specific respiration (succinate, glycerol-3-phosphate)

    • Inhibitor titration to determine Complex III-specific activity

  • Reactive oxygen species (ROS) measurements:

    • DCFH-DA fluorescence for general ROS detection

    • MitoSOX for mitochondria-specific superoxide detection

    • EPR spectroscopy for precise radical species identification

Enzymatic activity measurements should include proper controls and normalization to either protein content, citrate synthase activity, or other mitochondrial markers to account for differences in mitochondrial content between samples.

How does UQCRFS1 expression correlate with cancer progression and prognosis?

UQCRFS1 has emerged as a potential oncogene and prognostic biomarker in several cancers. In epithelial ovarian cancer (EOC):

  • Expression profile:

    • High expression in EOC tissues compared to normal controls

    • Elevated expression associated with poor prognosis

  • Molecular correlations:

    • Positive correlation with cell cycle genes (CDK2, CDK4, CCNE1)

    • Positive correlation with oxidative phosphorylation genes

    • Negative correlation with apoptosis genes (ADD1, BAX, FAS)

    • Negative correlation with DNA damage response genes (ATM, ATR)

  • Functional implications:

    • Promotes cancer cell proliferation

    • Regulates cell cycle progression

    • Inhibits apoptosis

    • Modulates oxidative stress response

The mechanistic basis appears to involve UQCRFS1's role in the AKT/mTOR signaling pathway, as knockdown studies demonstrated inhibition of this pathway in cancer cells . This suggests that UQCRFS1 may be a potential therapeutic target in cancers with elevated expression of this protein.

What are the clinical manifestations of UQCRFS1 mutations in mitochondrial disease?

Bi-allelic pathogenic variants in UQCRFS1 cause a distinct mitochondrial disease phenotype characterized by:

  • Clinical features:

    • Lactic acidosis

    • Fetal bradycardia

    • Hypertrophic cardiomyopathy

    • Alopecia totalis

  • Biochemical findings:

    • Reduced Complex III activity in patient fibroblasts

    • Impaired cellular respiration

    • Altered mitochondrial import of UQCRFS1

    • Defective Complex III assembly

  • Molecular basis:

    • Mutations affect critical functional domains of UQCRFS1

    • Impair incorporation of the iron-sulfur cluster

    • Disrupt protein stability and mitochondrial targeting

Diagnosis typically involves biochemical assays of respiratory chain complexes in patient-derived cells or tissues, followed by genetic testing. Complementation studies using wild-type UQCRFS1 can restore mitochondrial function in patient cells, confirming the causative nature of the identified variants .

How does UQCRFS1 dysfunction contribute to increased ROS production and DNA damage?

UQCRFS1 dysfunction significantly impacts cellular redox homeostasis:

  • Mechanistic pathway:

    • Impaired electron transfer through Complex III

    • Electron leakage from the respiratory chain

    • Increased superoxide production

    • Oxidative damage to mitochondrial and nuclear DNA

  • Experimental evidence:

    • UQCRFS1 knockdown leads to markedly enhanced ROS production detected by DCFH-DA fluorescence

    • Upregulation of DNA damage response genes (ATM, ATR)

    • Downregulation of checkpoint genes (CHK1, CHK2)

  • Cellular consequences:

    • Oxidative stress-induced cell cycle arrest

    • Accumulation of DNA damage

    • Activation of apoptotic pathways

    • Potential mutagenesis in surviving cells

Research approaches to study this relationship include redox-sensitive fluorescent probes, protein carbonylation assays, lipid peroxidation measurements, and DNA damage markers (γ-H2AX, 8-oxo-dG).

What are the key considerations when designing UQCRFS1 overexpression systems for functional rescue experiments?

Designing effective UQCRFS1 overexpression systems requires careful attention to several factors:

  • Expression vector design:

    • Include the complete coding sequence with proper mitochondrial targeting signal

    • Consider codon optimization for the host system

    • Use inducible promoters to control expression levels

    • Include appropriate epitope tags that don't interfere with function

  • Delivery methods:

    • Lentiviral transduction for stable integration and expression

    • Transfection for transient expression studies

    • Selection markers for establishing stable cell lines

  • Functional validation:

    • Confirm subcellular localization to mitochondria

    • Assess incorporation into Complex III by Blue Native-PAGE

    • Measure restoration of Complex III activity

    • Evaluate rescue of cellular phenotypes (growth, respiration, ROS levels)

Successful complementation studies have demonstrated that wild-type UQCRFS1 overexpression can restore mitochondrial function in cells with pathogenic UQCRFS1 variants, providing definitive evidence for the causative role of these variants in disease .

How can comparative analyses between bovine and human UQCRFS1 inform structural and functional studies?

Comparative analysis between bovine and human UQCRFS1 offers valuable insights:

  • Sequence conservation:

    • High degree of homology between bovine and human orthologs

    • Conserved functional domains, particularly the Rieske iron-sulfur binding motifs

    • Species-specific variations in non-catalytic regions

  • Structural implications:

    • Bovine UQCRFS1 has been extensively used in structural studies of Complex III

    • Differences in post-translational modifications may affect stability or regulation

    • Species-specific interactions with other Complex III components

  • Experimental applications:

    • Bovine protein can serve as a model for human studies when appropriately validated

    • Cross-species antibody reactivity should be verified experimentally

    • Functional differences may inform evolutionary adaptations in energy metabolism

Researchers should conduct careful alignment analyses and consider species-specific differences when extrapolating findings from bovine to human systems. Detailed structural analyses using techniques like hydrogen-deuterium exchange mass spectrometry can identify regions with different dynamics or solvent accessibility between the species.

What novel approaches are being developed to target UQCRFS1 for therapeutic purposes?

Emerging therapeutic approaches targeting UQCRFS1 include:

  • In cancer therapy:

    • Small molecule inhibitors of UQCRFS1 or its interactions

    • siRNA/shRNA therapeutic delivery systems

    • Antisense oligonucleotides to modulate expression

    • PROTAC-based approaches for targeted degradation

  • In mitochondrial disease:

    • Gene therapy to restore functional UQCRFS1

    • Pharmacological chaperones to stabilize mutant proteins

    • Bypass therapies targeting alternative energy pathways

    • Antioxidant approaches to mitigate ROS-induced damage

  • Screening methodologies:

    • Structure-based virtual screening against the iron-sulfur binding pocket

    • Phenotypic screens in disease-relevant cell models

    • Fragment-based drug discovery approaches

    • CRISPR-based genetic screens for synthetic lethality

Research in this area remains preliminary but shows promise given the central role of UQCRFS1 in both mitochondrial function and cancer progression. Therapeutic development should consider the essential nature of this protein in normal cellular metabolism to design approaches with acceptable therapeutic windows.

What are the key unanswered questions regarding UQCRFS1 regulation and function?

Several critical knowledge gaps remain in understanding UQCRFS1:

  • Regulatory mechanisms:

    • Transcriptional and post-transcriptional regulation

    • Post-translational modifications affecting function

    • Protein quality control and turnover pathways

    • Tissue-specific expression patterns and functions

  • Structural dynamics:

    • Conformational changes during the catalytic cycle

    • Interaction dynamics with other Complex III components

    • Structural adaptations under stress conditions

    • Role in supercomplex formation and stability

  • Pathophysiological roles:

    • Tissue-specific effects of mutations

    • Contribution to aging and neurodegenerative diseases

    • Role in metabolic reprogramming in cancer

    • Involvement in immune cell function and inflammation

Addressing these questions will require integrative approaches combining structural biology, proteomics, genetic models, and systems biology to provide a comprehensive understanding of UQCRFS1 in health and disease.

How might single-cell approaches advance our understanding of UQCRFS1 in heterogeneous tissues?

Single-cell technologies offer unprecedented insights into UQCRFS1 biology:

  • Single-cell transcriptomics:

    • Reveal cell type-specific expression patterns

    • Identify co-expression networks

    • Map transcriptional responses to mitochondrial dysfunction

    • Characterize heterogeneity in disease states

  • Single-cell proteomics:

    • Quantify UQCRFS1 protein levels in rare cell populations

    • Detect post-translational modifications

    • Map protein interactions in specific cell types

    • Correlate with functional mitochondrial parameters

  • Single-cell metabolomics:

    • Link UQCRFS1 function to metabolic phenotypes

    • Trace isotope-labeled metabolites through affected pathways

    • Identify metabolic signatures of UQCRFS1 dysfunction

    • Correlate with redox status and energy production

  • Integrative single-cell approaches:

    • Combined transcriptome/proteome analysis

    • Spatial transcriptomics to map expression in tissue context

    • Correlation with mitochondrial dynamics and morphology

    • Machine learning to identify cellular subtypes based on UQCRFS1-related features

These approaches will be particularly valuable for understanding the heterogeneous manifestations of UQCRFS1-related diseases and may lead to more targeted therapeutic interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.