Recombinant Bovine Cytochrome b561 (CYB561)
Description
Molecular Structure and Characteristics
Bovine Cytochrome b561 is a highly hydrophobic integral membrane protein consisting of 252-273 amino acids, with approximately half of its structure embedded within the lipid bilayer. The protein contains six transmembrane α-helical domains with minimal extramembranous sequence . The mature protein has a molecular weight of approximately 28 kDa and is characterized by its distinctive absorption maximum at 561 nm in its reduced state, which gives rise to its name .
The primary sequence of recombinant bovine CYB561 has been well-characterized. The full-length protein (1-252 amino acids) corresponds to the UniProt entry P10897, with the following amino acid sequence:
MEGPASPARAPGALPYYVAFSQLLGLIVVAMTGAWLGMYRGGIAWESALQFNVHPLCMIIGLVFLQGDALLVYRVFRNEAKRTTKVLHGLLHVFAFVIALVGLVAVFEHHRKKGYADLYSLHSWCGILVFALFFAQWLVGFSFFLFPGASFSLRSRYRPQHVFFGAAIFLLSVATALLGLKEALLFELGTKYSMFEPEGVLANVLGLLLATFATVILYILTRADWKRPLQAEEQALSMDFKTLTEGDSPSSQ .
A distinguishing structural feature of CYB561 is the presence of two heme-b prosthetic groups, each coordinated by highly conserved histidine residues located within the central four transmembrane helices . These heme centers are strategically positioned on opposite sides of the membrane, facilitating the protein's key function in transmembrane electron transport. Neither heme center is exposed to the aqueous environment, but rather they are embedded within the membrane-spanning domain of the protein, protected by the hydrophobic amino acid residues that surround them.
Spectroscopic Properties
Spectroscopic analysis of recombinant bovine CYB561 reveals distinctive features that characterize its structure and function. The protein exhibits a characteristic absorption spectrum with a maximum at 561 nm in its reduced state, which is the basis for its nomenclature . Additionally, Raman spectroscopic data indicate that both heme centers adopt a six-coordinated low-spin state in both reduced and oxidized forms .
Electron paramagnetic resonance (EPR) studies have identified two distinct heme species with gz values of 3.69 and 3.13, corresponding to the high-potential and low-potential heme centers, respectively . These EPR signals provide valuable information about the electronic environments of the two heme groups and their redox behaviors. Notably, the recombinant protein shows no significant EPR peak around gz = 3.16, which is usually associated with rhombic heme environments in other cytochrome b561 proteins .
Functional Properties and Biological Role
Bovine Cytochrome b561 serves as a critical component in the catecholamine biosynthesis pathway within chromaffin granules of the adrenal medulla. Its primary function is to transport reducing equivalents from cytoplasmic ascorbate across the vesicle membrane to intravesicular enzymes, particularly dopamine β-hydroxylase, which requires these electrons for the synthesis of norepinephrine from dopamine .
The protein's ability to facilitate transmembrane electron transfer is mediated by its two heme centers, which have different midpoint potentials (+150 mV and +60 mV) . This difference in redox potential creates an electron transport chain that enables the directional flow of electrons from the cytoplasmic side to the vesicular lumen. The higher potential heme (gz = 3.69) interacts with cytoplasmic ascorbate, while the lower potential heme (gz = 3.13) donates electrons to monodehydroascorbate radicals within the vesicle .
A unique characteristic of bovine CYB561 is its ascorbate reducibility. The protein exhibits differential affinity for ascorbate at its two heme centers, with distinct binding sites for the reducing agent. This property allows the protein to efficiently harness the reducing power of ascorbate for electron transport . The importance of this function is underscored by the protein's expression pattern, which is primarily restricted to the adrenal medulla and specific regions of the brain, tissues involved in catecholamine production and utilization .
Redox Properties
The two heme centers of bovine CYB561 exhibit distinct redox properties that are instrumental to the protein's electron transport function. As shown in Table 1, the high-potential heme has a midpoint potential of approximately +150 mV, while the low-potential heme has a midpoint potential of around +60 mV .
| Parameter | High-potential Heme | Low-potential Heme | Reference |
|---|---|---|---|
| Midpoint potential (mV) | +150 | +60 | |
| EPR signal (gz value) | 3.69 | 3.13 | |
| Ascorbate affinity | Higher | Lower |
This redox gradient facilitates the directional transfer of electrons from cytoplasmic ascorbate to intravesicular enzymes. Studies have shown that treatment with diethylpyrocarbonate causes a downshift in the midpoint potential of the lower-potential heme component, affecting its ascorbate reducibility without changing its gz value. Interestingly, this effect can be prevented by the presence of ascorbate during the treatment, suggesting a protective interaction between ascorbate and the heme center .
Recombinant Expression Systems
The recombinant expression of bovine CYB561 has been successfully achieved in various heterologous systems, enabling the production of functional protein for biochemical and structural studies. These expression systems include prokaryotic (E. coli) and eukaryotic (insect cells and yeast) hosts, each with distinct advantages and characteristics.
coli Expression System
Recombinant bovine CYB561 has been successfully expressed in E. coli, typically with the addition of an N-terminal histidine tag to facilitate purification . The protein is expressed as a full-length construct (1-252 amino acids) and can be obtained in a functional form that retains its characteristic spectroscopic and redox properties. The bacterial expression system offers advantages of simplicity, cost-effectiveness, and potential for high-yield production, although proper folding and insertion of the heme groups can be challenging for this integral membrane protein.
Insect Cell Expression System
The insect cell expression system, particularly Sf9 cells infected with recombinant baculovirus, has proven effective for the production of bovine CYB561. In this system, the bovine CYB561 coding sequence, often modified with a C-terminal hexahistidine tag, is cloned into a transfer vector (e.g., pVL1392) under the control of the polyhedrin promoter . This approach yields approximately 0.5 mg of detergent-solubilized CYB561 per liter of culture, providing sufficient material for detailed biochemical and structural analyses . The insect cell system offers advantages for membrane protein expression, including appropriate post-translational modifications and membrane insertion machinery.
Yeast Expression System
The methylotrophic yeast Pichia pastoris has also been successfully employed for the expression of recombinant bovine CYB561. In this system, the CYB561 cDNA is typically modified with a C-terminal hexahistidine tag and inserted into an expression vector (e.g., pPICZB) under the control of the alcohol oxidase promoter . Following transformation into Pichia pastoris GS115 cells, methanol induction leads to the expression of approximately 0.7 mg of detergent-solubilized CYB561 per liter of culture . The yeast system combines relatively high yields with eukaryotic protein processing capabilities, making it particularly suitable for the expression of membrane proteins.
Comparison of Expression Systems
Table 2 presents a comparison of the different expression systems used for the production of recombinant bovine CYB561.
Purification and Characterization
The purification of recombinant bovine CYB561 typically follows a standardized procedure that leverages the affinity tags incorporated into the recombinant constructs. For His-tagged variants, the protein can be readily solubilized from membrane fractions using detergents such as dodecyl maltoside and subsequently purified to electrophoretic homogeneity by one-step chromatography on Ni-NTA affinity resin .
The purified recombinant protein exhibits spectroscopic and functional properties that closely resemble those of the native cytochrome from chromaffin granules. Characterization studies have shown that the recombinant protein has a heme-to-protein ratio close to two, confirming the presence of both heme centers and suggesting proper folding and cofactor incorporation . Additionally, kinetic and spectroscopic analyses indicate that the recombinant protein is fully functional, capable of mediating electron transfer with properties similar to the endogenous cytochrome.
Research Applications and Significance
Recombinant bovine CYB561 serves as an important tool for investigating the structure and function of this unique electron transport protein. The availability of purified recombinant protein has facilitated detailed spectroscopic, biochemical, and structural studies that have contributed significantly to our understanding of transmembrane electron transport mechanisms and their role in catecholamine biosynthesis.
The protein's involvement in iron metabolism and redox homeostasis also positions it as a valuable model for studying these essential biological processes. Members of the CYB561 family contribute to the regulation of iron metabolism and various physiological and pathological processes by recycling ascorbic acid . This ascorbate-regenerating function has implications for cellular antioxidant defense mechanisms and may be relevant to diseases associated with oxidative stress.
Furthermore, some homologous proteins in humans and rodents are thought to participate in cancer pathology through mechanisms that are still being elucidated . Studies of recombinant bovine CYB561 can provide insights into the structure-function relationships that might be relevant to understanding the role of these proteins in disease contexts.
Analytical Applications
From an analytical perspective, recombinant bovine CYB561 can serve as a standard for various biochemical and biophysical techniques. Its well-characterized spectroscopic properties make it useful for calibrating and validating spectroscopic methods used in the study of heme proteins. Additionally, its defined electron transport properties provide a reference system for investigating other electron transfer proteins.
The protein is also suitable for applications in SDS-PAGE and other protein analysis techniques , making it valuable for method development and validation in protein biochemistry. Its defined molecular weight and amino acid composition make it a useful reference standard for these analytical approaches.
Product Specs
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request as much as possible.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Target Background
- Investigates the functional and structural roles of the EM3 residues and several adjacent residues (residues 70-85) in bovine cytochrome. PMID: 21401125
- Demonstrates that Cyb561 from chromaffin cell membranes possesses both high and low potential hemes, as evidenced by electron paramagnetic resonance and circular dichroism. PMID: 12438163
- Explores the possibility that pH-induced alteration and heme destruction in cytochrome b561 under oxidative conditions could play a significant role in amplifying oxidative stress in catecholaminergic neurons. PMID: 12653566
- The amino-terminal peptide analysis revealed that the initial Met residue was acetylated, but no other posttranslational modifications were observed in the amino-terminal region. PMID: 12768340
- Demonstrates that purified cytochrome b561 reconstituted into an artificial phospholipid bilayer is capable of transferring electron equivalents across the membrane to support the monooxygenase activity of soluble extravesicular dopamine beta-hydroxylase. PMID: 14769875
- Raman data suggests that the two heme b centers of CYB561 adopt a six-coordinated low-spin state, in both reduced and oxidized forms. PMID: 14999009
- Highlights the importance of the two well-conserved Cys residues near the intravesicular heme center. PMID: 16428304
- Provides a detailed characterization of cyt b561 using electron paramagnetic resonance (EPR) and optical spectroscopy on the wild-type and mutant forms of the cytochrome expressed in insect cells. PMID: 17602662
- These results indicate that His92 can be considered part of the b(H) heme center, and His110 part of the b(L) heme center, in adrenal cyt b(561). PMID: 18501187
Q&A
What is Cytochrome b561 (CYB561) and what are its key structural features?
Bovine adrenal chromaffin granule Cytochrome b561 (CYB561) is a transmembrane hemoprotein with approximately 252 amino acids. It contains six transmembrane helices and two heme groups, forming a homodimeric structure . The protein exhibits high hydrophobicity and contains two heme-b subunits embedded within the membrane bilayer . Spectroscopically, CYB561 has a maximum absorbance wavelength in the redox absorption spectrum of approximately 561 nm, which is reflected in its name . The protein's structure includes conserved histidine residues that coordinate the heme centers, with distinct high-potential (HP) and low-potential (LP) heme centers positioned on opposite sides of the membrane .
Table 1: Key Structural Features of Bovine CYB561
| Feature | Description |
|---|---|
| Protein Length | 252 amino acids |
| Molecular Structure | Six transmembrane helices, two heme groups |
| Quaternary Structure | Homodimer |
| Spectroscopic Property | Maximum absorbance at ~561 nm |
| Conserved Residues | Heme-coordinating histidines; Lys81 and His106 for substrate recognition |
| Heme Arrangement | High-potential (cytosolic side) and low-potential (intra-vesicular side) |
What is the primary physiological function of bovine CYB561?
Bovine CYB561 plays a key role in transporting reducing equivalents from ascorbate to dopamine-beta-hydroxylase for catecholamine synthesis . As an ascorbate-dependent oxidoreductase, it mediates transmembrane electron transport (TMET) across chromaffin granule membranes . This electron transport function is critical for:
-
Regenerating ascorbate through monodehydroascorbate reductase activity
-
Functioning as a Fe³⁺-reductase, providing reduced iron for transmembrane transport
-
Supporting catecholamine synthesis in chromaffin granules
The protein can transmit electrons across the membrane through sequential reduction and oxidation of its HP and LP-hemes, with the negatively charged substrate ascorbate or monodehydroascorbate enclosed in positively charged pockets on either side of the membrane .
Which expression systems are most effective for producing recombinant bovine CYB561?
Several expression systems have been developed for recombinant bovine CYB561, each with distinct advantages:
Insect Cell Expression (Sf9):
-
Yield: Approximately 0.5 mg detergent-solubilized CYB561/L culture
-
Method: The bovine CYB561 coding sequence (with or without a C-terminal hexahistidine-tag) is cloned into the pVL1392 transfer vector under polyhedrin promoter control to generate recombinant baculovirus
-
Advantages: Good post-translational modifications, membrane protein folding
Yeast Expression (Pichia pastoris):
-
Yield: Approximately 0.7 mg detergent-solubilized CYB561/L culture
-
Method: The CYB561 cDNA is modified with a C-terminal hexahistidine-tag and inserted into the pPICZB vector under alcohol oxidase promoter control, then transformed into P. pastoris GS115 cells for methanol-inducible expression
-
Advantages: Higher yield, eukaryotic folding machinery, cost-effective
E. coli Expression:
-
Method: Full-length bovine CYB561 protein (1-252aa) with N-terminal His-tag can be expressed in E. coli
-
Advantages: Rapid growth, simplicity, high protein yield
-
Limitations: Potential challenges with membrane protein folding and heme incorporation
For researchers focusing on functional studies, insect or yeast expression systems are recommended as they produce properly folded protein with a heme-to-protein ratio close to the theoretical maximum of two .
What are the optimal purification strategies for recombinant bovine CYB561?
The most efficient purification strategy for recombinant bovine CYB561 involves:
-
Membrane Fraction Isolation:
-
Harvest cells and disrupt by appropriate method (sonication or mechanical disruption)
-
Isolate membrane fractions by differential centrifugation
-
-
Solubilization:
-
Affinity Chromatography:
-
Quality Control:
The purified recombinant cytochrome from both insect and yeast systems has been shown to have a heme-to-protein ratio close to two and to be fully functional, based on spectroscopic and kinetic parameters comparable to the endogenous cytochrome from chromaffin granules .
How can researchers accurately assess the functional activity of recombinant bovine CYB561?
Functional characterization of recombinant bovine CYB561 can be performed using several complementary approaches:
Spectroscopic Analysis:
-
UV-visible spectroscopy to confirm characteristic absorption peaks (~561 nm)
-
Redox difference spectra to verify proper heme incorporation
-
EPR studies to characterize the electronic properties of the heme centers
Electron Transfer Kinetics:
-
Measure ascorbate-dependent electron transfer rates
-
Analyze reduction kinetics using stopped-flow spectroscopy
-
Compare kinetic parameters with native protein from chromaffin granules
Ferrireductase Activity:
-
Measure Fe³⁺ to Fe²⁺ reduction rates
-
Quantify Fe²⁺ concentration using colorimetric assays (e.g., ferrozine assay)
-
Compare activity with and without ascorbate as electron donor
Mutagenesis Studies:
-
Create targeted mutations in conserved residues (particularly heme-coordinating histidines and substrate-binding sites like Lys81 and His106)
When comparing recombinant protein with native CYB561, researchers should evaluate spectroscopic properties, kinetic parameters, and structural integrity to ensure full functionality of the recombinant protein.
What are the critical amino acid residues for CYB561 function and how can they be investigated?
Several critical amino acid residues are essential for CYB561 function:
Heme-Coordinating Histidines:
-
Mutations in His residues coordinating the LP-heme (intra-vesicular side) result in nearly undetectable protein levels
-
Mutations in the HP-heme-coordinating residues affect ASC-reduction kinetics and reduce heme content
Substrate Recognition and Catalysis:
-
Lys81 and His106 play essential roles in substrate recognition and catalysis
-
Mutation of K83 in maize CYB561B1 (homologous to bovine CYB561) resulted in altered midpoint redox potentials and ASC-reduction kinetics
Investigation Methods:
-
Site-Directed Mutagenesis:
-
Generate single-point mutations in conserved residues
-
Express and purify mutant proteins using established protocols
-
-
Functional Characterization:
-
Compare spectroscopic properties with wild-type protein
-
Measure electron transfer kinetics and substrate binding affinities
-
Determine redox potentials of mutant proteins
-
-
Structural Analysis:
-
If possible, obtain crystal structures of mutant proteins
-
Use computational modeling to predict structural changes
-
Table 2: Effects of Mutations on Key Residues in CYB561
| Residue | Location | Effect of Mutation |
|---|---|---|
| HP-heme His | Cytosolic side | Altered ASC-reduction kinetics, reduced heme content |
| LP-heme His | Intra-vesicular side | Nearly undetectable protein levels |
| Lys81 | Substrate binding pocket | Impaired substrate recognition |
| His106 | Catalytic site | Reduced catalytic activity |
How can recombinant bovine CYB561 be used to investigate electron transfer mechanisms across biological membranes?
Recombinant bovine CYB561 serves as an excellent model system for studying transmembrane electron transfer (TMET) mechanisms:
Reconstitution Studies:
-
Reconstitute purified CYB561 into liposomes or nanodiscs
-
Create asymmetric conditions mimicking physiological environments
-
Measure directional electron transfer across the membrane
Real-time Electron Transfer Monitoring:
-
Utilize rapid kinetic methods (stopped-flow spectroscopy)
-
Implement electrochemical techniques to measure electron transfer rates
-
Develop fluorescent probes to visualize electron transfer in real-time
Comparative Analysis with Other CYB561 Family Members:
-
Express and characterize different CYB561 family members
-
Compare electron transfer mechanisms between family members
-
Identify conserved and divergent aspects of electron transfer
Coupling with Partner Proteins:
-
Investigate interactions with physiological partners (e.g., dopamine β-monooxygenase)
-
Measure electron transfer rates in coupled systems
-
Determine rate-limiting steps in physiological electron transfer pathways
These approaches can provide insights into fundamental mechanisms of biological electron transfer, with implications for understanding energy transduction, redox homeostasis, and transmembrane signaling.
What is the relationship between CYB561 function and iron metabolism, and how can it be studied using recombinant protein?
CYB561 plays a critical role in iron metabolism through its ferrireductase activity:
Mechanistic Relationship:
-
CYB561 contributes to cellular iron homeostasis by reducing Fe³⁺ to Fe²⁺
-
This ferrireductase function maintains vesicular redox states
-
CYB561 works in conjunction with other iron regulatory proteins such as transferrin receptor (TFRC) and ferritin (FTH)
Experimental Approaches:
-
Iron Reduction Assays:
-
Measure Fe²⁺ concentrations using colorimetric assays (e.g., ferrozine)
-
Compare wild-type and mutant CYB561 ferrireductase activities
-
Investigate the impact of ascorbate availability on iron reduction
-
-
Expression Analysis of Iron-Regulated Genes:
-
In Vitro Iron Transport Systems:
-
Reconstitute CYB561 with iron transporters in liposomes
-
Measure iron transport rates across membranes
-
Determine how CYB561 activity couples with transport processes
-
Research has shown that CYB561 knockdown affects cellular Fe²⁺ concentrations and alters the expression of iron-regulated genes like TFRC, highlighting the protein's role in iron metabolism pathways .
What are common challenges in expressing and purifying functional recombinant bovine CYB561, and how can they be addressed?
Researchers face several challenges when working with recombinant bovine CYB561:
Low Expression Levels:
-
Challenge: Membrane proteins often express poorly in heterologous systems
-
Solution: Screen multiple expression systems (insect cells, yeast, bacterial); optimize codon usage; use stronger promoters; consider fusion partners to enhance expression
Improper Heme Incorporation:
-
Challenge: Insufficient heme incorporation leads to non-functional protein
-
Solution: Supplement growth media with δ-aminolevulinic acid (heme precursor); optimize growth conditions; verify heme content spectroscopically
Protein Instability:
-
Challenge: Membrane proteins can be unstable when removed from their native environment
-
Solution: Screen different detergents for solubilization; optimize buffer conditions (pH, ionic strength); include stabilizing agents like glycerol
Purification Issues:
-
Challenge: Obtaining homogeneous, functional protein
-
Solution: Use affinity tags (His-tag) for one-step purification; optimize chromatography conditions; verify protein integrity by SDS-PAGE and western blotting
Table 3: Troubleshooting Guide for Recombinant Bovine CYB561
| Issue | Possible Cause | Solution |
|---|---|---|
| Low yield | Poor expression | Try different expression systems; optimize growth conditions |
| Inactive protein | Inadequate heme incorporation | Supplement growth media with heme precursors |
| Protein aggregation | Improper solubilization | Screen detergents; adjust buffer conditions |
| Impure preparation | Inefficient purification | Optimize affinity chromatography; add secondary purification steps |
How can researchers design experiments to investigate the impact of post-translational modifications on CYB561 function?
Post-translational modifications (PTMs) may significantly affect CYB561 function, and can be investigated through:
Identification of PTMs:
-
Use mass spectrometry (MS) to identify potential PTMs in native bovine CYB561
-
Compare PTM patterns between native and recombinant proteins
-
Analyze protein from different expression systems to determine system-specific PTMs
Site-Directed Mutagenesis:
-
Generate mutants at putative PTM sites (e.g., phosphorylation, glycosylation)
-
Create phosphomimetic mutations (e.g., Ser/Thr to Asp/Glu) to mimic phosphorylation
-
Compare functional properties of wild-type and mutant proteins
Expression in Different Systems:
-
Express protein in systems with varying PTM capabilities
-
Compare E. coli (limited PTMs) with insect cells and yeast (more extensive PTMs)
-
Analyze functional differences between proteins from different systems
PTM Enzymatic Manipulation:
-
Treat purified protein with specific enzymes (phosphatases, glycosidases)
-
Measure changes in activity after enzymatic treatment
-
Correlate activity changes with specific PTMs
These approaches can provide insights into how PTMs regulate CYB561 function, potentially revealing mechanisms for fine-tuning its electron transfer and ferrireductase activities in different physiological contexts.
How can recombinant bovine CYB561 research contribute to understanding cancer progression mechanisms?
Recent research has revealed important connections between CYB561 and cancer progression:
Cancer Relevance:
-
CYB561 expression is upregulated in breast cancer compared to normal controls
-
High CYB561 expression is associated with adverse clinicopathological factors in breast cancer
-
CYB561 has been identified as a potential biomarker for diagnosis and prognosis of breast cancer
-
CYB561 supports the neuroendocrine phenotype in castration-resistant prostate cancer
Research Approaches:
-
Comparative Expression Analysis:
-
Functional Studies:
-
Mechanistic Investigations:
Research has shown that knockout of CYB561 inhibits the growth of breast cancer cells, suggesting a critical role in cancer cell proliferation. Additionally, CYB561 may influence immune-tumor interactions through its role in redox processes and metal ion homeostasis .
What methodologies can be used to investigate the role of CYB561 in neurodegenerative disorders?
Given CYB561's role in neurological processes, researchers can employ several methodologies to investigate its involvement in neurodegenerative disorders:
Expression Analysis in Disease Models:
-
Analyze CYB561 expression in brain tissues from neurodegenerative disease models
-
Compare expression patterns across different brain regions and disease stages
-
Correlate CYB561 levels with markers of oxidative stress and neurodegeneration
Functional Studies:
-
Develop neuronal cell models with modified CYB561 expression
-
Measure effects on neuronal survival, function, and response to oxidative stress
-
Examine impacts on catecholamine metabolism and neuropeptide signaling
CYB561-Dopamine Connection:
-
Study how CYB561 affects dopamine synthesis through its role in supporting dopamine β-hydroxylase
-
Investigate relationships between CYB561 function and Parkinson's disease pathophysiology
-
Examine potential neuroprotective effects of enhanced CYB561 function
Therapeutic Targeting:
-
Screen for compounds that modulate CYB561 activity
-
Test potential therapeutic agents in cellular and animal models
-
Evaluate combined approaches targeting both CYB561 and related pathways
These methodologies can help elucidate CYB561's role in neurodegenerative processes and potentially identify new therapeutic strategies for conditions like Parkinson's disease and other neurological disorders.
What novel biotechnological applications could be developed based on the electron transfer properties of recombinant bovine CYB561?
The unique electron transfer capabilities of CYB561 present opportunities for innovative biotechnological applications:
Biosensor Development:
-
Design electrochemical biosensors utilizing CYB561's electron transfer capability
-
Develop systems for detection of ascorbate levels in biological samples
-
Create biosensors for monitoring redox states in complex environments
Biocatalysis:
-
Engineer CYB561 variants with enhanced or altered electron transfer capabilities
-
Develop biocatalytic systems for stereoselective reductions
-
Create enzyme cascades incorporating CYB561 for multi-step redox transformations
Bioelectronics:
-
Integrate CYB561 into bioelectronic devices for energy conversion
-
Develop protein-based components for biocompatible electronic systems
-
Create biological interfaces for electronic devices
Drug Delivery Systems:
-
Design CYB561-incorporated liposomes for redox-responsive drug release
-
Develop systems that utilize transmembrane electron transfer for controlled release
-
Create targeted delivery systems based on CYB561 properties
These applications could potentially transform areas ranging from analytical biochemistry to biomedical engineering, leveraging the unique properties of this transmembrane electron transfer protein.
How might advanced structural biology techniques further our understanding of CYB561 function?
Advanced structural biology techniques could significantly enhance our understanding of CYB561:
Cryo-Electron Microscopy (Cryo-EM):
-
Determine high-resolution structures of CYB561 in different functional states
-
Visualize conformational changes during electron transfer
-
Analyze protein-protein interactions with physiological partners
Time-Resolved X-ray Crystallography:
-
Capture intermediates in the electron transfer process
-
Determine structural changes during substrate binding and catalysis
-
Visualize electron transfer pathways through the protein
Molecular Dynamics Simulations:
-
Model CYB561 behavior in membrane environments
-
Simulate electron transfer processes at atomic resolution
-
Predict effects of mutations on protein structure and function
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
-
Map protein dynamics and conformational changes
-
Identify regions involved in substrate binding
-
Detect structural perturbations caused by mutations
Single-Molecule Techniques:
-
Monitor individual electron transfer events
-
Measure conformational dynamics at the single-molecule level
-
Correlate structural changes with functional states
