Recombinant Bovine Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Dry ice shipping incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Uniprot No.

Target Background

Function
Recombinant Bovine Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This enzyme complex, along with succinate dehydrogenase (complex II, CII) and ubiquinol-cytochrome c oxidoreductase (complex III, CIII), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, comprising heme A3 and copper B (CuB). The BNC reduces molecular oxygen to water using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Gene References Into Functions
  1. The proton-pumping mechanism in bovine heart cytochrome c oxidase involves a hydrogen-bond network and a water channel situated between the membrane's positive and negative sides. (PMID: 21718684)
  2. Spectroscopic analysis reveals no protein-based radical in the reaction of O2 with reduced bCcO. (PMID: 21718686)
  3. His503 plays a role in proton supply to the D-pathway as a proton acceptor in cytochrome c oxidase. (PMID: 21565155)
  4. The axial methionine residue modestly increases the redox potential of the CuA site. (PMID: 21745457)
  5. Subunits I, II, and III of bovine heart cytochrome c oxidase are encoded by the mitochondrial genome. (PMID: 21320464)
  6. Bovine placentomes exhibit a significant increase (70-100-fold) in COX-II mRNA levels during pre- and intrapartum. (PMID: 16375967)
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase Subunit 2 (MT-CO2) and what is its role in cellular metabolism?

Cytochrome c oxidase subunit 2 (MT-CO2), also known as COX2, COII, COXII, or MTCO2, is a critical component of cytochrome c oxidase (CcO), the terminal enzyme complex in the mitochondrial electron transport chain. This protein is encoded by the mitochondrial genome and functions as an integral part of the CcO complex, which contains 13 different subunits with four redox-active metal centers, two copper sites, and two heme a groups . The primary function of CcO is to accept electrons from cytochrome c and transfer them to molecular oxygen, reductively converting O₂ to water. This process is coupled with proton pumping across the inner mitochondrial membrane, generating the electrochemical gradient necessary for ATP synthesis . MT-CO2 is particularly important in this process as it contributes to the active center where electron transfer occurs.

How can researchers effectively verify the identity and purity of recombinant MT-CO2?

Verification of recombinant MT-CO2 identity and purity requires multiple complementary techniques. Begin with SDS-PAGE to assess protein size and initial purity, followed by western blotting using specific antibodies against MT-CO2. Mass spectrometry (particularly MALDI-TOF or LC-MS/MS) should be employed to confirm the exact molecular weight and sequence coverage. For functional validation, incorporate the recombinant protein into purified CcO complexes and measure enzymatic activity changes . Additionally, circular dichroism spectroscopy can verify proper protein folding.

Blue Native PAGE (BN-PAGE) is particularly valuable for confirming the integration of recombinant MT-CO2 into the CcO complex, as demonstrated in studies where recombinant proteins were successfully incorporated into highly purified bovine CcO . Researchers should expect to observe a band corresponding to the complete CcO complex with the incorporated recombinant protein when performing immunoblotting after BN-PAGE.

What experimental methodologies are most effective for studying MT-CO2 interactions with regulatory proteins?

Studying MT-CO2 interactions with regulatory proteins requires sophisticated experimental approaches. In vitro pull-down assays have proven effective for demonstrating direct interactions, as evidenced by studies using maltose binding protein-fused bovine regulatory proteins (like Higd1a) with highly purified bovine CcO . This approach successfully demonstrated that regulatory proteins can directly integrate into the CcO complex.

For more detailed interaction studies, researchers should consider:

  • Blue Native PAGE followed by immunoblotting: This technique can confirm macromolecular complex formation and integration of regulatory proteins into the CcO complex .

  • Resonance Raman spectroscopy: This advanced technique can detect structural changes around the active centers (particularly heme a) when regulatory proteins bind to the CcO complex, providing insights into the molecular mechanisms of regulation .

  • Enzyme activity assays: Measuring changes in CcO enzymatic activity when recombinant regulatory proteins are added can provide functional evidence of interaction. Studies have shown that direct addition of regulatory proteins to highly purified CcO can significantly increase enzyme activity, sometimes doubling it compared to controls .

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry can identify specific amino acid residues involved in protein-protein interactions.

How does MT-CO2 contribute to mitochondrial disorders and what methods best characterize pathogenic variants?

MT-CO2 pathogenic variants have been implicated in mitochondrial disorders including cerebellar ataxia and neuropathy . The definitive characterization of pathogenic MT-CO2 variants requires a multi-faceted approach combining genetic, biochemical, and histological methods.

Diagnostically, muscle biopsies from patients have proven essential for identifying pathogenic variants. The methodology typically involves:

  • Mitochondrial DNA sequencing: Next-generation sequencing of the mitochondrial genome from muscle samples to identify potential MT-CO2 variants .

  • Heteroplasmy quantification: Development of quantitative pyrosequencing assays to determine heteroplasmy levels (the proportion of mutant mtDNA) in various tissues. This technique should be capable of detecting heteroplasmy levels as low as 3% .

  • Tissue distribution analysis: Investigation of variant heteroplasmy across multiple tissues including skeletal muscle, urinary sediments, blood, and buccal epithelia to establish tissue-specific patterns .

  • Single-fiber analysis: Laser-capture microdissection of individual COX-deficient and COX-positive muscle fibers followed by quantitative analysis of variant heteroplasmy to establish correlations between biochemical defects and genetic variants .

  • Familial segregation studies: Analysis of the suspected pathogenic variants in non-invasive tissues from maternal relatives to establish inheritance patterns and potential threshold effects .

This comprehensive approach is critical for distinguishing truly pathogenic variants from benign polymorphisms, particularly when multiple heteroplasmic variants are present.

What is the relationship between MT-CO2 and oxygen sensing, particularly under hypoxic conditions?

The relationship between MT-CO2 and oxygen sensing involves complex regulatory mechanisms that adapt mitochondrial function to changing oxygen availability. Research indicates that CcO activity, including MT-CO2 function, increases in response to hypoxia through specific regulatory proteins .

One key mechanism involves the hypoxia-inducible domain family member 1A (Higd1a), which is transiently induced under hypoxic conditions and directly interacts with the CcO complex . Experimental evidence shows that Higd1a:

  • Directly integrates into the CcO complex containing MT-CO2

  • Causes structural changes around the active centers, particularly near heme a

  • Significantly increases CcO enzymatic activity

  • Enhances oxygen consumption and subsequent ATP synthesis

  • Improves cell viability under hypoxic conditions

The methodological approach to studying this relationship typically involves:

  • Cell culture under controlled hypoxic conditions: Exposing cells to precisely controlled oxygen levels to induce hypoxia-responsive genes

  • Gene expression analysis: Monitoring changes in MT-CO2 and regulatory protein expression under hypoxia

  • Protein-protein interaction studies: Using pull-down assays and BN-PAGE to detect interactions between regulatory proteins and CcO

  • Resonance Raman spectroscopy: Detecting structural changes in the active centers of CcO when bound to regulatory proteins

  • Oxygen consumption measurements: Quantifying changes in cellular or isolated mitochondrial oxygen consumption under different conditions

  • ATP synthesis assays: Measuring ATP production capacity as a functional outcome of altered CcO activity

These approaches reveal how MT-CO2, as part of the CcO complex, participates in the cellular response to hypoxia, representing an important adaptation mechanism.

What are the optimal conditions for expressing and purifying functional recombinant MT-CO2?

Expressing and purifying functional recombinant MT-CO2 presents significant challenges due to its hydrophobic nature and requirement for proper folding. Based on available research, the following optimized protocol is recommended:

  • Expression system selection: While Escherichia coli has been used successfully for expressing regulatory proteins that interact with CcO , membrane proteins like MT-CO2 often require eukaryotic expression systems such as insect cells (Sf9 or High Five) or mammalian cells (HEK293 or CHO) to ensure proper folding and post-translational modifications.

  • Construct design: Include a cleavable affinity tag (His6, MBP, or GST) to facilitate purification. The MBP tag has shown particular effectiveness in improving solubility while maintaining function, as demonstrated in studies with CcO-interacting proteins .

  • Solubilization and purification: Use mild detergents (DDM, LMNG, or digitonin) for membrane protein extraction. Employ a multi-step purification process including affinity chromatography, ion exchange, and size exclusion chromatography.

  • Functional validation: Confirm activity by incorporating the recombinant protein into purified bovine CcO complexes and measuring enzymatic activity before and after incorporation .

  • Storage conditions: Store purified protein in buffer containing 20-25% glycerol at -80°C to maintain long-term stability and activity.

This approach should yield functional recombinant MT-CO2 suitable for structural and functional studies, though researchers should expect significant optimization based on their specific experimental needs.

What spectroscopic techniques provide the most insight into MT-CO2 structural dynamics?

Multiple spectroscopic techniques offer complementary insights into MT-CO2 structural dynamics, with each providing distinct advantages:

  • Resonance Raman spectroscopy: This technique has proven particularly valuable for studying structural changes around the active centers of CcO, especially the heme groups. It can detect subtle conformational changes when regulatory proteins bind to the complex or when redox states change . Research has demonstrated that this method can identify specific structural alterations around heme a that correlate with changes in enzymatic activity .

  • Fourier Transform Infrared Spectroscopy (FTIR): Useful for analyzing protein secondary structure and detecting changes in hydrogen bonding networks, which are critical for proton pumping function .

  • Circular Dichroism (CD): Provides information about secondary structure elements and can monitor conformational changes under different conditions.

  • Electron Paramagnetic Resonance (EPR): Particularly valuable for studying the metal centers in CcO, including those that interact with MT-CO2.

  • X-ray Absorption Spectroscopy (XAS): Offers detailed information about the coordination environment of metal ions within the protein complex.

For optimal results, researchers should combine multiple spectroscopic approaches. For instance, coupling resonance Raman with EPR can provide comprehensive insights into both structural changes and metal center properties during enzyme function or regulatory protein binding .

How can researchers effectively measure CcO enzymatic activity in experimental systems incorporating recombinant MT-CO2?

Measuring CcO enzymatic activity in systems with recombinant MT-CO2 requires precise methodologies to detect functional changes. Based on published research, the following protocol is recommended:

  • Preparation of enzyme complex: For in vitro studies, highly purified bovine CcO (hpCcO) prepared from microcrystals used for X-ray structural analysis provides a reliable system . The recombinant MT-CO2 should be incorporated into this complex through incubation under optimized conditions.

  • Activity measurement: The standard approach involves spectrophotometric monitoring of cytochrome c oxidation at 550 nm. The reaction mixture typically contains:

    • Reduced cytochrome c (10-50 μM)

    • Potassium phosphate buffer (50 mM, pH 7.4)

    • The CcO complex with incorporated recombinant MT-CO2

    • Optional: n-dodecyl-β-D-maltoside (0.1%) to maintain enzyme stability

  • Controls: Always include:

    • Native CcO without recombinant protein

    • CcO with control proteins (e.g., MBP tag alone)

    • Heat-inactivated samples

  • Data analysis: Calculate the reaction rate from the linear portion of the absorbance decrease curve. Research has demonstrated that regulatory proteins can significantly affect activity, sometimes doubling it compared to controls .

  • Alternative approaches: For more comprehensive assessment, consider oxygen consumption measurements using oxygen electrodes or cellular respiration analysis using Seahorse XF analyzers to evaluate MT-CO2 function in cellular contexts.

When properly implemented, these methods can reliably detect functional changes resulting from MT-CO2 variants or interactions with regulatory proteins, providing valuable insights into the biological roles of this critical subunit.

How might MT-CO2 be involved in cellular responses beyond energy production?

Beyond its established role in energy production, emerging research suggests MT-CO2, as part of the CcO complex, may participate in cellular signaling pathways and stress responses. The CcO complex appears to function as an oxygen sensor that influences cellular adaptation to changing oxygen availability . When regulatory proteins like Higd1a interact with the CcO complex containing MT-CO2, they trigger structural changes that alter both enzyme activity and potentially its signaling functions .

Several intriguing research directions include:

  • Apoptosis regulation: CcO activity modulation may influence cytochrome c release and subsequent apoptotic signaling, particularly under stress conditions.

  • Retrograde signaling: Changes in CcO function due to MT-CO2 modifications may trigger nuclear gene expression changes through retrograde mitochondria-to-nucleus signaling pathways.

  • Metabolic reprogramming: MT-CO2 and the CcO complex might serve as metabolic checkpoints that influence broader cellular metabolic programs beyond simple ATP production.

  • Interaction with hypoxia-responsive pathways: The demonstrated interaction between hypoxia-induced factors and CcO suggests potential crosstalk with well-established hypoxia signaling cascades, including HIF-1α pathways .

To investigate these non-canonical functions, researchers should consider experimental approaches that combine genetic manipulation of MT-CO2 with comprehensive proteomics, metabolomics, and transcriptomics analyses to identify novel interaction partners and downstream effects.

What is the current state of knowledge regarding tissue-specific functions of MT-CO2 variants?

Current research indicates that MT-CO2 variants demonstrate tissue-specific effects, with certain tissues showing greater vulnerability to specific mutations. Studies of pathogenic MT-CO2 variants reveal that skeletal muscle, nervous tissue (particularly cerebellum), and highly aerobic tissues typically show the most pronounced phenotypes .

Key observations include:

  • Heteroplasmy distribution: MT-CO2 variant heteroplasmy levels often differ significantly between tissues, with skeletal muscle typically showing higher mutation loads than blood or buccal samples .

  • Threshold effects: The biochemical phenotype (COX deficiency) appears only when the heteroplasmy level exceeds a tissue-specific threshold, which varies depending on the specific variant and tissue energy demands .

  • Cellular mosaicism: Single-fiber analysis of muscle biopsies reveals a mosaic pattern of affected and unaffected cells, with COX-deficient fibers typically showing significantly higher heteroplasmy levels than COX-positive fibers .

Future research should focus on:

  • Determining the molecular basis for tissue-specific vulnerability to MT-CO2 variants

  • Identifying potential compensatory mechanisms in resistant tissues

  • Developing tissue-targeted therapeutic approaches based on tissue-specific pathophysiology

This knowledge will be crucial for developing precision medicine approaches for patients with MT-CO2-related mitochondrial disorders.

How do post-translational modifications affect recombinant MT-CO2 function compared to native protein?

Post-translational modifications (PTMs) represent a critical but often overlooked aspect of MT-CO2 function. Current research in this area is limited, but evidence suggests that several types of PTMs may significantly impact MT-CO2 function within the CcO complex:

  • Phosphorylation: Potential phosphorylation sites in MT-CO2 may regulate enzyme activity in response to cellular signaling. Researchers should investigate whether kinases directly target MT-CO2 and how phosphorylation affects interaction with other subunits.

  • Oxidative modifications: As part of an oxygen-consuming enzyme, MT-CO2 may be particularly susceptible to oxidative modifications under certain conditions, potentially creating feedback regulation mechanisms.

  • Proteolytic processing: Some studies suggest that precise proteolytic processing may be important for proper MT-CO2 assembly into the CcO complex.

When working with recombinant MT-CO2, researchers should consider:

  • Expression system selection: Eukaryotic expression systems may better recapitulate the native PTM profile than bacterial systems .

  • PTM analysis: Mass spectrometry-based approaches to identify and quantify PTMs in both native and recombinant proteins.

  • Functional comparison: Systematic comparison of native and recombinant protein functions using enzymatic assays to identify activity differences that might be attributed to PTMs.

  • Engineered modifications: Site-directed mutagenesis to mimic or prevent specific PTMs for functional studies.

These approaches will help clarify the role of PTMs in fine-tuning MT-CO2 function and may reveal new regulatory mechanisms worth exploring for therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.