Recombinant Bovine Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping is available upon request; please contact us in advance for pricing and arrangements.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX4I1; COX4; Cytochrome c oxidase subunit 4 isoform 1, mitochondrial; Cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit IV isoform 1; COX IV-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-169
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELY RLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQT KRMLDMKVAPIQGFSAKWDYDKNEWKK
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 4 isoform 1 (COX4I1) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center comprised of heme A3 and CuB) in subunit 1. This binuclear center reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Gene References Into Functions
  1. Structure of bovine cytochrome c oxidase crystallized at neutral pH: PMID: 28695851
  2. Charge translocation patterns in cytochrome c oxidase coupled to the transfer of the 3rd and 4th electrons: PMID: 21889506
  3. Time-resolved resonance Raman spectroscopy of whole mitochondria identifying an oxygenated intermediate: PMID: 22172733
  4. Effect of amino acid replacement in proton channels and Zn2+ binding on proton pumping: PMID: 22100820
  5. Nitric oxide binding to reduced ba3 and bovine cytochrome aa3: PMID: 22201543
  6. X-ray structure of heart cytochrome c oxidase and O2 binding: PMID: 22236806
  7. Electron transfer from Ru(II) to CuA in cytochrome c oxidase: PMID: 21939635
  8. Master-equation models and proton pumping reversibility: PMID: 21946020
  9. His291 model of proton pumping in cytochrome c oxidase: PMID: 22086149
Database Links
Protein Families
Cytochrome c oxidase IV family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is bovine Cytochrome c Oxidase Subunit 4 Isoform 1 (COX4I1) and what role does it play in mitochondrial function?

Bovine COX4I1 is a nuclear-encoded subunit of cytochrome c oxidase (CcO), which forms complex IV of the mitochondrial electron transport chain. This protein is critical for the assembly and function of the CcO macromolecular complex, which catalyzes the final step in the respiratory chain - the reduction of oxygen to water while simultaneously pumping protons across the mitochondrial inner membrane . COX4I1 plays an essential role in mitochondrial homeostasis and energy metabolism, as it is directly involved in establishing the necessary interfaces between different CcO subunits, particularly between COX4I1 and COX5A, which is required for the formation of the COX1 module .

How is recombinant bovine COX4I1 typically produced for research applications?

Recombinant bovine COX4I1 is typically produced using prokaryotic expression systems, most commonly in Escherichia coli . The production process generally involves:

  • Cloning the COX4I1 gene into an appropriate expression vector

  • Transforming the construct into a suitable E. coli strain

  • Inducing protein expression under optimized conditions

  • Cell lysis and extraction of the recombinant protein

  • Purification using techniques such as affinity chromatography

  • Formulation in a stabilizing buffer containing components like Tris, NaCl, EDTA, DTT, and trehalose

The purified protein is often freeze-dried for long-term storage and stability, reaching purities of over 95% for research applications .

What functional differences exist between monomeric and dimeric forms of bovine cytochrome c oxidase?

Research using amphipol-stabilized CcO has demonstrated that the monomeric form exhibits higher enzymatic activity than the dimeric form . Structural analysis reveals that a hydrogen bond network of water molecules forms at the entry surface of the proton transfer pathway (K-pathway) in monomeric CcO, whereas this network is altered in the dimeric configuration .

Based on these findings, researchers propose that the monomer represents the activated form of CcO, while the dimer may function as a physiological standby form in the mitochondrial membrane. Moreover, recent structural analyses of mitochondrial respiratory supercomplexes have shown that CcO monomer associates with complex I and complex III, further indicating that the monomeric state is functionally important .

What critical functional domains have been identified in COX4I1 and how do they contribute to complex IV assembly?

High-density CRISPR gene tiling scans have identified two critical peptide regions in COX4I1 that are essential for its function:

Table 1: Critical Functional Domains of COX4I1

DomainPositionFunctionEffect of Disruption
P1 regionK67-L73Establishes interface between COX4I1 and COX5A; necessary for COX1 module formationImpaired cell proliferation and mitochondrial respiration
P2 regionE136-K169 (C-terminal)Co-localizes with intermembrane space domains of COX2/COX3 modulesCompromised assembly of intact complex IV

The P1 region faces the mitochondrial matrix and is critical for establishing the interface between COX4I1 and COX5A, which is necessary for the formation of the COX1 module. While the P2 region (C-terminal 34 residues) is dispensable for COX1 module formation, it co-localizes with the intermembrane space domains of the COX2/COX3 modules and is required for assembling a fully functional complex IV .

How does recombinant protein incorporation affect the assembly and activity of bovine CcO complex?

Studies with recombinant Higd1a have demonstrated that exogenous proteins can be directly incorporated into purified bovine CcO complexes, affecting both structure and function. When recombinant Higd1a produced in E. coli was introduced to CcO complex purified from bovine heart, it directly associated with and integrated into the already assembled complex . This incorporation led to increased CcO activity, suggesting that the introduction of recombinant proteins can modulate complex function .

The direct binding of recombinant proteins to CcO can be confirmed through in vitro pull-down assays, while Blue Native PAGE followed by immunoblotting can verify integration into the macromolecular complex . These findings suggest that recombinant COX4I1 could similarly be incorporated into pre-assembled CcO complexes, potentially allowing researchers to study structure-function relationships through controlled protein modifications.

What impact do COX4I1 mutations have on mitochondrial function and associated pathologies?

Mutations in COX4I1 can result in a rare autosomal recessive disorder characterized by:

  • Growth retardation

  • Slow weight gain

  • Microcephaly

  • Developmental regression

  • Intellectual disability

  • Seizures

  • Progressive cerebral atrophy

A clinical case study documented a 6-year-old boy with compound heterozygosity for a de novo 16q24.1 deletion and a P152T missense mutation in COX4I1. The patient exhibited developmental regression, epilepsy, low body weight, microcephaly, generalized muscle hypotonia, and progressive cerebral atrophy .

At the molecular level, COX4I1 deficiency leads to impaired assembly of complex IV, compromised mitochondrial respiration, and reduced ATP production. These effects are particularly damaging in tissues with high energy demands, such as the brain, which explains the predominant neurological manifestations of COX4I1 mutations .

What techniques are most effective for measuring the activity of recombinant bovine COX4I1 within the CcO complex?

The optimal protocol for expressing and purifying functional recombinant bovine COX4I1 involves:

  • Expression System: Prokaryotic expression in E. coli is most commonly used for COX4I1 production .

  • Vector Selection: Choose vectors with strong, inducible promoters and appropriate tags to facilitate purification. Fusion proteins (e.g., MBP-tagged constructs) may improve solubility and facilitate downstream applications .

  • Purification Strategy:

    • Initial capture using affinity chromatography based on fusion tags

    • Further purification via ion-exchange chromatography

    • Final polishing using size-exclusion chromatography

  • Buffer Formulation: Optimal stability is achieved in buffers containing components such as:

    • 20mM Tris, 150mM NaCl, pH 8.0

    • 1mM EDTA and 1mM DTT as stabilizers

    • 5% Trehalose to maintain protein structure

    • Small amounts of detergent for hydrophobic regions

  • Quality Control: Verify purity via SDS-PAGE (>95% purity is typically achievable) and confirm functional activity through the techniques described in section 3.1 .

What are the challenges in studying the structure-function relationship of bovine COX4I1 and how can they be overcome?

The primary challenges in studying COX4I1 structure-function relationships include:

  • Membrane Protein Complexity: As part of a large membrane-bound complex, COX4I1 presents inherent structural analysis difficulties.

  • Native Conformation Preservation: Maintaining the native state during purification and structural studies is challenging.

  • Functional Integration: Ensuring recombinant COX4I1 properly incorporates into the CcO complex for functional studies.

These challenges can be addressed through several strategies:

  • Use of Amphipol Stabilization: Research has shown that amphipol-stabilized CcO maintains functional activity and allows discrimination between monomeric and dimeric forms .

  • Novel Detergent Synthesis: Development of specialized detergents has enabled determination of both oxidized and reduced structures of monomeric CcO at high resolution (1.85Å and 1.95Å, respectively) .

  • Comparative Analysis: Studying structural differences between monomeric and dimeric forms provides insights into activation mechanisms, such as the formation of hydrogen bond networks at the K-pathway entry surface .

  • Molecular Interface Mapping: Identification of critical peptide regions (such as P1: K67-L73 and P2: E136-K169) helps focus structural studies on functionally relevant domains .

How does COX4I1 function contribute to cancer metabolism, particularly in acute myeloid leukemia?

Recent research has identified COX4I1 as a novel essential gene for acute myeloid leukemia (AML) maintenance . CRISPR-knockout studies of COX4I1 in AML cells demonstrated:

  • Inhibited cell proliferation

  • Reduced colony formation

  • Attenuated leukemia progression in vivo

  • Elevated mitochondrial stress

  • Dysregulated mitochondrial cristae structure

  • Impaired mitochondrial respiration (measured by oxygen consumption rate)

  • Depleted cellular ATP levels

This indicates that COX4I1 plays a pivotal role in maintaining mitochondrial homeostasis and energy metabolism in AML cells. Furthermore, knockout of COX4I1 induced mitochondrial stress that triggered cellular ferroptosis in AML cells, accompanied by an imbalanced cellular redox index (reduced GSH/GSSG ratio) and elevated lipid peroxidation .

These findings suggest that COX4I1 represents a potential vulnerability in AML that could be exploited therapeutically, particularly when combined with mitochondria-targeting therapeutics such as Venetoclax (ABT-199) .

How does COX4I1 compare to the tissue-specific isoform COX4I2, and what are the physiological implications of isoform switching?

Studies with COX4I2-knockout mice have provided important insights into the functional differences between COX4I1 and its tissue-specific isoform COX4I2:

Table 3: Comparison of COX4I1 and COX4I2 Isoforms

ParameterCOX4I1COX4I2
Expression patternUbiquitousTissue-specific (lung, brain, heart)
RegulationConstitutiveInduced by hypoxia in some tissues
Metabolic effect of knockoutDevelopmental disorders, growth impairmentReduced lung COX activity (−50%), decreased cellular ATP (−29%)
Physiological effect of knockoutNeurological manifestations, developmental regressionDecreased airway responsiveness, lung pathology deteriorating with age

In COX4I2-knockout mice, lung-specific effects included reduced enzyme activity, decreased airway responsiveness (60% reduced Penh and 58% reduced airway resistance upon methacholine challenge), and development of lung pathology that deteriorated with age .

The existence of tissue-specific isoforms suggests a mechanism for adapting respiratory chain function to tissue-specific metabolic demands and oxygen availability. The COX4I2 isoform may be particularly important in lung tissue, where its loss leads to significant respiratory phenotypes .

What potential exists for COX4I1-targeted therapies in mitochondrial disorders and cancer?

The emerging understanding of COX4I1's role in both mitochondrial disorders and cancer suggests two distinct therapeutic directions:

  • For COX4I1 Deficiency Disorders:

    • Gene therapy approaches to restore functional COX4I1 expression

    • Development of small molecules that can stabilize partially assembled complex IV

    • Metabolic interventions to enhance alternative energy production pathways

    • Antiepileptic strategies for managing neurological manifestations

  • For Cancer Targeting (particularly AML):

    • Development of inhibitors targeting the critical P1 (K67-L73) and P2 (E136-K169) regions of COX4I1

    • Combination therapies with existing mitochondria-targeting drugs like Venetoclax

    • Exploitation of metabolic vulnerabilities created by COX4I1 dependence

    • Induction of ferroptosis through COX4I1 inhibition

The identification of COX4I1 as essential for AML maintenance suggests it could represent a novel vulnerability in cancer metabolism. Further research is needed to develop selective approaches that can target COX4I1 in cancer cells while sparing normal tissues with high energy demands .

What are the most promising approaches for elucidating the complete structure of bovine COX4I1 within the CcO complex?

Future structural studies of bovine COX4I1 within the CcO complex would benefit from:

  • Crystallization of the CcO-Higd1a complex to reveal conformational changes around the heme a site, building on existing research that has achieved high-resolution structures (1.85Å for oxidized and 1.95Å for reduced forms) of monomeric CcO .

  • Application of cryo-electron microscopy to visualize the dynamic assembly process of complex IV, with particular focus on the integration of COX4I1.

  • Advanced molecular dynamics simulations to understand the hydrogen bond networks and water molecule arrangements at the K-pathway entry surface that differ between monomeric and dimeric forms .

  • Mapping of phospholipid structures based on electron density together with the anomalous scattering effect of phosphorus atoms, especially at the interface regions important for supercomplex formation .

How might synthetic biology approaches enhance the production and functionality of recombinant bovine COX4I1?

Synthetic biology offers several promising avenues for advancing COX4I1 research:

  • Optimized Expression Systems: Development of specialized E. coli strains or cell-free systems specifically designed for efficient production of membrane proteins like COX4I1.

  • Engineered Fusion Constructs: Creation of novel fusion proteins that enhance solubility, stability, and function while facilitating purification and structural studies.

  • Rational Design: Structure-guided modifications to enhance stability or activity based on the identified critical regions (P1: K67-L73 and P2: E136-K169) .

  • Protein Stabilization: Application of novel amphipathic polymers (amphipols) that have shown promise in preserving the native structure and activity of membrane proteins like those in the CcO complex .

  • Functional Reconstitution: Development of minimal synthetic systems that reconstitute COX4I1 function within artificial membrane environments for mechanistic studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.