Recombinant Bovine D (1A) dopamine receptor (DRD1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine D(1A) Dopamine Receptor (DRD1)

The Recombinant Bovine D(1A) Dopamine Receptor (DRD1) is a bioengineered protein derived from the dopamine D1 receptor, a G protein-coupled receptor (GPCR) critical for neuronal signaling and development. This variant is produced in Saccharomyces cerevisiae (yeast) and represents a partial-length construct designed for research applications . DRD1 is the most abundant dopamine receptor subtype in the central nervous system, regulating neuronal growth, synaptic plasticity, and cognitive functions .

Key Production Details

ParameterValue/Description
Uniprot IDQ95136
Expression HostYeast (Saccharomyces cerevisiae)
Purity>85% (SDS-PAGE)
Molecular Weight~49.3 kDa (partial construct)
TagDetermined during manufacturing (e.g., His, GST)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) + glycerol

The recombinant protein is lyophilized or provided in liquid form, with a shelf life of 12 months at -20°C/-80°C (lyophilized) or 6 months at -20°C/-80°C (liquid) .

Role of DRD1 in Dopamine Signaling

DRD1 couples with Gαs proteins to stimulate adenylyl cyclase, increasing intracellular cAMP and activating protein kinase A (PKA) . In human neural stem cells, DRD1’s constitutive activity (basal signaling without ligand binding) regulates neurogenesis via the PKC-CBP pathway, balancing proliferation and differentiation . While bovine DRD1 shares structural homology with human DRD1, its precise functional roles in cattle remain under investigation.

Research Applications

ApplicationPurpose
Signaling StudiesInvestigate GPCR activation mechanisms
Drug DevelopmentTest ligand binding or constitutive activity modulators
Neurological ModelsStudy dopamine-related pathologies (e.g., Parkinson’s)

The bovine variant may serve as a model for understanding DRD1’s evolution and species-specific signaling .

FeatureBovine DRD1Human DRD1Mouse DRD1
Uniprot IDQ95136P21728P21728 (ortholog)
Expression HostYeastHuman cells (e.g., HEK293)Yeast/HEK293
Key ApplicationsStructural/catalytic studiesNeurological disease modelsBehavioral studies
Constitutive ActivityNot explicitly studiedHigh (human NSCs) Moderate (rodent models)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is finalized during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
DRD1; D1AR; D(1A dopamine receptor; Dopamine D1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MRTLNTSTMEGTGLVAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTGPSEGNATSLG KTINNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRISALERAAVHAKN CQTTTGNGNPMECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGS GETKPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPTTNNAIET VSINNNGAVVFSSHHEPRGSISKDCNVVYLIPHAVGSSEGLKKEEAVGIAKPLEKLSPAL SVILDYDTDVSLEKIQPITQNGQHPT
Uniprot No.

Target Background

Function

The dopamine receptor D1A (DRD1A) is a G protein-coupled receptor that activates adenylyl cyclase.

Gene References Into Functions
  1. Significant differences in allelic frequencies of DRD1, DRD4, and DRD5 markers were observed between Bos taurus and Bos indicus breeds exhibiting varying temperaments. PMID: 26909995
Database Links

KEGG: bta:281125

STRING: 9913.ENSBTAP00000054107

UniGene: Bt.9029

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, dendritic spine.

Q&A

What is DRD1 and what are its primary functions in the nervous system?

DRD1 (Dopamine D1 receptor) is the most abundantly expressed dopamine receptor in the central nervous system, serving as the primary receptor mediating excitatory dopamine signaling across multiple dopaminergic pathways . It belongs to the G protein-coupled receptor (GPCR) family and primarily couples to the Gs family of G proteins to activate adenylyl cyclase and induce cAMP production .

The receptor plays several critical roles in neural function:

  • Regulation of neural stem cell (NSC) proliferation and differentiation during brain development

  • Modulation of prefrontal cortex activity during working memory tasks

  • Enhancement of signal-to-noise ratio in prefrontal neurons

  • Maintenance of basal neurogenic gene expression through constitutive activity

Notably, DRD1 exhibits significant constitutive activity (activity in the absence of ligand binding), which research has shown plays an important role in the development of the human nervous system by influencing neural stem cell maintenance and neurogenesis .

How does recombinant bovine DRD1 compare structurally to human DRD1?

While the search results don't provide specific information about bovine DRD1, researchers should approach species differences systematically when working with recombinant bovine DRD1:

  • Sequence homology analysis should be performed to identify:

    • Conserved binding pocket residues that interact with dopamine

    • Potential differences in allosteric binding sites

    • Variations in G protein coupling interfaces

    • Regions that might influence constitutive activity levels

  • Critical functional domains to compare include:

    • The orthosteric binding pocket where dopamine and compounds like SKF81297 bind

    • Allosteric modulation sites that interact with compounds like LY3154207

    • Regions involved in G protein coupling

    • Domains affecting constitutive activity, particularly residues analogous to A229 and L286 in human DRD1

What expression systems are most suitable for recombinant bovine DRD1 production?

The choice of expression system for recombinant bovine DRD1 should be guided by the intended experimental application:

  • Mammalian cell systems (HEK293, CHO cells):

    • Advantages: Native-like post-translational modifications, proper membrane insertion

    • Best suited for: Functional studies, ligand screening, signaling assays

    • Considerations: Monitor expression levels to avoid potential toxicity from constitutive activity

  • Insect cell systems (Sf9, Hi5 cells):

    • Advantages: Higher protein yields, mammalian-like processing

    • Best suited for: Structural studies requiring larger protein quantities

    • Considerations: May require optimization of culture conditions for proper folding

  • Yeast expression systems:

    • Advantages: Cost-effective, suitable for large-scale production

    • Best suited for: Initial expression screening, mutational analysis

    • Considerations: Different membrane composition may affect receptor properties

Methodological approach: Test multiple expression systems in parallel with quality control checks for proper folding, ligand binding, and functional coupling to G proteins before selecting the optimal system for your specific research needs.

What purification strategies yield functional recombinant DRD1?

Based on general GPCR purification principles and available information about DRD1, a systematic purification strategy should include:

  • Solubilization optimization:

    • Screen detergents compatible with DRD1 stability (typically DDM, LMNG, GDN)

    • Consider addition of cholesterol or specific lipids during solubilization

    • Include ligands (agonists or antagonists) during solubilization to stabilize specific conformations

  • Affinity purification:

    • Utilize affinity tags such as His-tags (mentioned in connection with recombinant DRD1)

    • Consider adding stabilizing ligands in purification buffers

    • Optimize buffer conditions (pH, salt concentration) to maintain receptor integrity

  • Quality control methods:

    • Validate proper folding through binding assays with known ligands

    • Confirm functionality through G protein coupling or signaling assays

    • Assess homogeneity through size exclusion chromatography

    • Verify stability using thermal shift assays

Methodological approach: Develop a multi-step purification protocol with quality control checkpoints at each stage to ensure the final preparation contains properly folded, functional receptors.

How does the constitutive activity of DRD1 impact experimental design and data interpretation?

DRD1's constitutive activity presents specific methodological challenges that researchers must address:

  • Experimental design considerations:

    • Always include proper baseline measurements to account for ligand-independent activity

    • Distinguish between neutral antagonists (blocking only agonist effects) and inverse agonists (reducing constitutive activity)

    • Consider the impact of expression levels on baseline signaling

  • Data interpretation challenges:

    • Signaling responses should be normalized to basal activity levels

    • Changes in constitutive activity may be misinterpreted as responses to experimental conditions

    • Cellular background may influence apparent constitutive activity levels

  • Control strategies:

    • Include known inverse agonists (like SKF83566) as reference compounds

    • Consider using constitutively inactive mutants (similar to A229T) as negative controls

    • Compare results in multiple cell backgrounds

From the research data: "The A229T mutation was reported to reduce the constitutive activity of receptor, and our experiment proved that the mutant could increase the proliferation of NSCs. The L286A mutation could increase the constitutive activity of receptor and reduce the proliferation of NSCs" . This demonstrates how constitutive activity levels directly impact biological readouts and must be carefully controlled in experimental designs.

What methodological approaches can effectively characterize DRD1 ligand binding properties?

A comprehensive characterization of recombinant bovine DRD1 ligand binding requires multiple complementary approaches:

  • Radioligand binding assays:

    • Saturation binding to determine receptor density and affinity

    • Competition binding to measure binding affinities of unlabeled compounds

    • Kinetic studies to determine association/dissociation rates

    • Experimental design must account for both orthosteric and allosteric binding sites

  • Functional coupling assays:

    • cAMP accumulation assays (ELISA, BRET/FRET-based sensors)

    • G protein recruitment assays (BRET/FRET)

    • β-arrestin recruitment assays

    • Bioluminescence/fluorescence complementation methods

  • Biophysical approaches:

    • Surface plasmon resonance for label-free binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Fluorescence-based thermal shift assays to measure ligand-induced stabilization

ApproachKey ParametersAdvantagesLimitations
Radioligand bindingKd, Bmax, Ki valuesGold standard, quantitativeRadiation hazards, limited to labeled ligands
cAMP signalingEC50, Emax, basal activityFunctional readout, high throughputIndirect measure of binding
Biophysical methodskon, koff, ΔH, ΔSDirect measurement, no labeling requiredLower throughput, requires purified protein

When interpreting results, researchers should consider that DRD1 exists in a complex with various G proteins in crystal structures , suggesting that binding properties may vary depending on the presence of signaling partners.

How can researchers effectively study DRD1 allosteric modulation mechanisms?

Based on information from search result , DRD1 positive allosteric modulators (PAMs) like LY3154207, CID2886111, and DETQ offer unique advantages over orthosteric ligands. Studying these mechanisms requires specialized approaches:

  • Structural characterization approaches:

    • Utilize cryo-EM or X-ray crystallography to visualize allosteric binding sites, as demonstrated with LY3154207

    • Perform molecular dynamics simulations to understand conformational changes

    • Use hydrogen-deuterium exchange mass spectrometry to identify regions affected by allosteric binding

  • Functional assays for allosteric effects:

    • Measure effects on orthosteric ligand binding (cooperativity)

    • Determine changes in signaling efficacy with fixed orthosteric ligand concentrations

    • Assess pathway-specific effects (biased signaling) through multiple readouts

    • Characterize effects on receptor thermostability

  • Analytical frameworks:

    • Apply operational models of allosterism to quantify cooperativity

    • Calculate allosteric parameters (α for affinity effects, β for efficacy effects)

    • Develop structure-activity relationships for allosteric binding sites

Methodological approach: Design experiments that can distinguish between different modes of allosteric modulation, including PAMs that enhance agonist effects, negative allosteric modulators that diminish signaling, and silent allosteric modulators that affect binding without changing efficacy.

What signaling pathways should be evaluated when characterizing recombinant bovine DRD1?

A comprehensive characterization of DRD1 signaling should examine multiple pathways based on evidence from the search results:

  • Primary Gs/cAMP pathway:

    • As a D1-like receptor, DRD1 primarily couples to Gs to activate adenylyl cyclase

    • Measurement methods: cAMP accumulation assays, PKA activity assays, CREB phosphorylation

    • Experimental design should include concentration-response relationships and time-course analyses

  • PKC-CBP signaling pathway:

    • Research indicates "the PKC-CBP pathway was involved in the regulation by DRD1"

    • Measurement methods: PKC activity assays, CBP phosphorylation status, histone modification analysis (H3K27ac, H3K27me3)

    • This pathway appears particularly important for neurogenic gene expression regulation

  • Constitutive signaling component:

    • Measure basal activity in the absence of ligands

    • Compare wild-type receptor with constitutively inactive mutants (A229T)

    • Assess effects of inverse agonists like SKF83566

Signaling PathwayKey Measurable ParametersRelevance to DRD1 Function
Gs/cAMP/PKAcAMP levels, PKA activity, CREB phosphorylationPrimary signal transduction mechanism
PKC-CBPPKC activity, CBP phosphorylation, histone modificationsRegulation of neurogenic gene expression
Constitutive activityBasal cAMP, ligand-independent signalingNeural stem cell maintenance, neurogenesis

The search results indicate that these pathways are physiologically relevant: "DRD1 partially mediates its action on NSCs by downregulating the genesis of neurons in a CBP/p300-dependent fashion through reducing PKC phosphorylation" .

How does the transcriptomic context of DRD1 impact the interpretation of recombinant receptor studies?

Search result provides crucial insights about DRD1's functional relationship with its coexpression partners. This has significant implications for recombinant receptor research:

  • Transcriptomic context significance:

    • DRD1 functions within a coexpression network that influences working memory performance

    • Genetically predicted coexpression of this network (DRD1-PCI) correlates with prefrontal cortex activity

    • Isolated recombinant systems may not recapitulate these network-dependent functions

  • Methodological limitations of recombinant systems:

    • Standard expression systems lack the natural coexpression partners

    • Cell types used for recombinant expression may have different signaling machinery

    • Transcriptional regulation of the receptor itself may differ from endogenous contexts

  • Approaches to address these limitations:

    • Identify and co-express key members of the DRD1 coexpression network

    • Use cell backgrounds that better mimic the native cellular environment

    • Validate findings in more complex systems (tissue slices, organoids, in vivo)

From the research: "The regulation of DRD1 expression is polygenic, rather than only based on genetic variants proximal to DRD1, and is embedded in the context of gene network coexpression" . This suggests that researchers should consider genetic background effects and potentially develop more sophisticated model systems that incorporate aspects of this coexpression network.

What are effective quality control methods for verifying the functionality of recombinant bovine DRD1?

A systematic quality control workflow should include:

  • Protein-level validation:

    • Expression levels: Western blotting, ELISA, or flow cytometry

    • Glycosylation status: Glycosidase sensitivity assays

    • Oligomeric state: Size exclusion chromatography, native PAGE

    • Thermal stability: Fluorescence-based thermal shift assays

  • Functional validation:

    • Ligand binding: Competition binding with reference ligands (dopamine, SKF81297)

    • G protein coupling: BRET/FRET assays measuring G protein recruitment

    • Signaling: cAMP accumulation assays, with and without forskolin

    • Constitutive activity: Comparison with known inverse agonists (SKF83566)

  • Structural integrity assessment:

    • Limited proteolysis to verify proper folding

    • Antibody binding to conformational epitopes

    • Circular dichroism to assess secondary structure content

    • Microscopy to confirm membrane localization (for cell-based assays)

Quality control decision tree:

  • First validate expression and membrane localization

  • Then confirm binding of reference ligands

  • Next verify functional coupling to G proteins

  • Finally assess downstream signaling cascade activation

This systematic approach ensures that the recombinant receptor not only expresses but also maintains the key functional properties required for meaningful experimental outcomes.

How can researchers effectively design assays to study constitutive activity of recombinant DRD1?

Based on the approaches described in search result , studying DRD1 constitutive activity requires specialized experimental designs:

  • Cellular proliferation assays:

    • CellTiter-Glo assay to measure ATP levels

    • EdU incorporation to quantify DNA synthesis

    • CCK8 assay to assess metabolic activity

    • Neurosphere formation assays for self-renewal capacity

These approaches were effectively used to demonstrate that "SKF83566, an inverse agonist that inhibits the constitutive activity of the DRD1, induced a significantly higher growth rate of human NSC" .

  • Genetic approaches:

    • CRISPR-Cas9 genome editing to introduce mutations affecting constitutive activity

    • shRNA knockdown of DRD1 to compare with pharmacological inhibition

    • Site-directed mutagenesis targeting key residues like A229 and L286

  • Biochemical assays:

    • Measure basal cAMP levels in the absence of ligands

    • Compare wild-type with constitutively inactive mutants

    • Assess inverse agonist effects on basal signaling

Methodological approach: Design experiments with parallel pharmacological and genetic interventions to distinguish receptor-specific effects from off-target actions. Include appropriate controls for each assay, and validate findings across multiple experimental systems.

What experimental approaches can elucidate the relationship between DRD1 and neural development?

Search result provides extensive information about DRD1's role in neural development that can guide experimental design:

  • Neural stem cell models:

    • 2D adherent culture systems with NSC markers (Sox1, Sox2, Nestin)

    • Neurosphere assays to assess self-renewal capacity

    • Differentiation assays monitoring neuronal marker expression

    • Measurement of proliferation markers like Ki67

  • Cerebral organoid approaches:

    • Generation of 3D cerebral organoids as described in

    • Assessment of organoid size, ventricular zone expansion, and cortical folding

    • Histological analysis of proliferative versus differentiated zones

    • Manipulation of DRD1 activity using inverse agonists or genetic approaches

  • Molecular mechanism investigation:

    • Analysis of PKC-CBP pathway activation

    • Assessment of histone modifications (H3K27ac, H3K27me3)

    • Gene expression profiling of neurogenic genes

    • Chromatin immunoprecipitation to identify CBP binding sites

The search results indicate that "inactivation of DRD1 promoted human NSCs proliferation and arrested neuronal differentiation, thereby causing the excessive expansion and folding in an in vitro model of human cerebral organoids" . This provides a clear phenotypic readout for experimental manipulation of recombinant bovine DRD1 in developmental contexts.

How can researchers design experiments to study the relationship between DRD1 and working memory circuits?

Search result offers insights into DRD1's role in working memory that can inform experimental approaches:

  • Electrophysiological methods:

    • Patch-clamp recordings to measure persistent neural firing

    • Field potential recordings to assess network activity

    • Optogenetic manipulation of DRD1-expressing neurons

    • Measurement of signal-to-noise ratio in prefrontal cortex circuits

  • Functional imaging approaches:

    • Calcium imaging in neural networks

    • Voltage-sensitive dye imaging

    • In vivo imaging during working memory tasks

    • Correlation of DRD1 activity with prefrontal cortex efficiency

  • Genetic and pharmacological interventions:

    • Manipulation of DRD1 expression levels

    • Application of selective agonists, antagonists, or inverse agonists

    • Testing the effects of allosteric modulators on working memory circuits

    • Genetic manipulation of the DRD1 coexpression network

From the research: "D1Rs enhance the signal-to-noise ratio in PFC neurons during WM performance by promoting activity in recurrent circuits" . This provides a key functional endpoint that can be measured in various experimental systems, from in vitro neuronal cultures to in vivo models.

How might findings from recombinant bovine DRD1 studies translate to human therapeutic applications?

While maintaining focus on research methodologies rather than commercial applications, translational considerations include:

  • Cross-species comparison framework:

    • Systematic comparison of bovine and human DRD1 pharmacology

    • Identification of conserved binding sites for potential therapeutic targeting

    • Validation of key findings in human cell lines or tissues

    • Understanding species differences in constitutive activity

  • Therapeutic modality considerations:

    • Orthosteric versus allosteric approaches

    • Agonists versus inverse agonists depending on the therapeutic goal

    • Consideration of constitutive activity effects

  • Potential application areas based on search results:

    • Neurodevelopmental disorders: DRD1 constitutive activity regulates neural stem cell proliferation and differentiation

    • Working memory deficits: DRD1 signaling enhances prefrontal cortex efficiency

    • Parkinson's disease: DRD1 PAMs may offer therapeutic opportunities

Methodological approach: Design translational studies that include both bovine and human DRD1 in parallel, focusing on conserved mechanisms while acknowledging species differences. Validate findings across multiple experimental systems of increasing complexity.

How can researchers effectively study DRD1 allosteric modulators in recombinant systems?

Search result mentions several DRD1 positive allosteric modulators (PAMs) including LY3154207, CID2886111, and DETQ, providing a foundation for systematic study:

  • Structural approaches:

    • Utilizing cryo-EM or X-ray crystallography as in

    • Molecular modeling of allosteric binding sites

    • Structure-based design of novel modulators

    • Identification of key residues through mutagenesis

  • Pharmacological characterization:

    • Measurement of allosteric parameters (α, β values)

    • Assessment of probe dependence with different orthosteric ligands

    • Evaluation of binding kinetics and residence time

    • Testing for biased modulation of different signaling pathways

  • Functional validation:

    • Effects on dopamine potency and efficacy

    • Modulation of constitutive activity

    • Impact on receptor desensitization and internalization

    • Cooperativity with endogenous ligands

From the research: "GPCR positive allosteric modulators (PAMs) have been proposed to provide unique advantages over orthosteric agonists including greater receptor subtype selectivity, saturable therapeutic effects and the ability to maintain spatial and temporal patterns of endogenous dopamine signaling" . This highlights the importance of designing assays that can specifically detect these advantageous properties in recombinant systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.