Recombinant Bovine D (2) dopamine receptor (DRD2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is dependent on numerous factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
DRD2; D(2 dopamine receptor; Dopamine D2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MDPLNLSWYDDDPESRNWSRPFNGSEGKADRPPYNYYAMLLTLLIFVIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPMLFGLNNTDQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRANLKAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKTVNPKIAKIFEIQSMPNGKTRTSLKTMS RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS AVNPIIYTTFNIEFRKAFLKILHC
Uniprot No.

Target Background

Function
Dopamine receptor whose activity is mediated by G proteins, which inhibit adenylyl cyclase. Positively regulates postnatal regression of retinal hyaloid vessels via suppression of VEGFR2/KDR activity, downstream of OPN5.
Gene References Into Functions
  1. Studied a novel Dopamine Receptor 2 (DRD2) G/A SNP for resistance to fescue toxicosis. PMID: 24299180
Database Links

KEGG: bta:281126

STRING: 9913.ENSBTAP00000014422

UniGene: Bt.4300

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of the bovine D(2) dopamine receptor?

The bovine D(2) dopamine receptor (DRD2) is a G protein-coupled receptor that appears as a single polypeptide band of approximately 120,000 Da when analyzed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. This molecular weight has been confirmed through multiple detection methods including radioiodinated Bolton-Hunter reagent labeling, Coomassie Blue staining, and silver staining techniques .

The receptor spans the cell membrane with a multi-pass membrane protein topology . Like other dopamine receptors, it contains seven transmembrane domains with extracellular N-terminus and intracellular C-terminus regions. The binding pocket for ligands is formed within the transmembrane bundle, similar to the human D2R structure revealed through cryo-electron microscopy at near-atomic resolution .

How does the bovine DRD2 compare to human D2 dopamine receptors?

Bovine and human D2 dopamine receptors share significant structural and functional homology. Both are G protein-coupled receptors that primarily signal through inhibitory G proteins (Gi/Go), which inhibit adenylyl cyclase activity . The ligand binding profiles show similarities, with both receptors having high affinity for typical D2 receptor antagonists like spiperone and typical agonists.

Structurally, both receptors demonstrate similar coupling to G proteins, as evidenced by research showing that purified bovine D2 receptors can mediate agonist stimulation of GTPase activity when reconstituted with brain Gi/Go proteins .

What are the recommended methods for expressing recombinant bovine DRD2?

The expression of recombinant bovine DRD2 can be achieved through several expression systems, with insect cells being particularly effective. Based on protocols used for similar dopamine receptors, the following methodology is recommended:

  • Clone the full-length bovine DRD2 cDNA into a suitable expression vector containing a strong promoter

  • Consider adding N-terminal tags such as BRIL (thermostabilized apocytochrome b562RIL) to improve expression and stability, similar to approaches used for human D2R

  • Express the receptor in Sf9 insect cells using a baculovirus expression system

  • Include a purification tag (e.g., His-tag) for subsequent purification steps

  • Culture the cells at 27°C for 48-72 hours post-infection before harvesting

For mammalian expression systems, HEK293 cells have also proven effective, especially when studying functional aspects requiring mammalian-specific post-translational modifications.

What are the key challenges in obtaining pure and functional recombinant bovine DRD2?

Several challenges exist in producing pure and functional recombinant bovine DRD2:

  • Protein Stability: As a membrane protein, DRD2 is inherently unstable when removed from the lipid bilayer. Maintaining its native conformation during purification requires careful selection of detergents.

  • Low Expression Levels: GPCRs typically express at low levels in heterologous systems, necessitating optimization of expression conditions and possibly the use of expression-enhancing tags.

  • Proper Folding: Ensuring correct protein folding and post-translational modifications, especially glycosylation, which affects receptor trafficking and function. The bovine DRD2 can be purified using lectin affinity chromatography (Datura stramonium lectin-agarose), indicating the presence of specific glycosylation patterns .

  • Functionality Assessment: Verifying that the recombinant receptor maintains its functional properties, including ligand binding and G protein coupling. Purification protocols should be validated by demonstrating that the purified receptor retains a KD for [3H]spiperone of 5-8 nM in detergent solutions, which improves to approximately 160 pM after reinsertion into phospholipid vesicles .

  • Aggregation Issues: Preventing protein aggregation during concentration steps through careful buffer optimization and the addition of stabilizing agents.

How can I optimize the purification protocol for recombinant bovine DRD2?

Optimizing purification of recombinant bovine DRD2 requires a strategic approach based on established protocols. A refined methodology based on previous successful purifications includes:

  • Sequential Chromatography: Implement a three-step purification strategy using:

    • Affinity chromatography with immobilized carboxymethyleneoximinospiperone-Sepharose

    • Lectin affinity chromatography using Datura stramonium lectin-agarose

    • Hydroxylapatite chromatography

This approach has yielded approximately 33,000-fold purification to apparent homogeneity .

  • Detergent Selection: Critical for maintaining receptor structure while solubilizing from membranes. Consider starting with a mild detergent such as DDM (n-dodecyl-β-D-maltoside) at 1% for solubilization, followed by 0.1% for purification steps.

  • Stabilizing Ligands: Include a high-affinity antagonist (like spiperone) throughout purification to stabilize the receptor conformation.

  • Buffer Optimization:

    • pH: Maintain at 7.4-7.5

    • Salt concentration: 100-150 mM NaCl

    • Glycerol: 10-15% to enhance stability

    • Protease inhibitors: Complete cocktail to prevent degradation

  • Quality Control Checkpoints: Monitor purification progress by measuring specific binding activity, which should approach 5.3 nmol of [3H]spiperone bound per mg of protein in highly purified preparations .

  • Functional Reconstitution: For functional studies, reconstitute purified receptors into phospholipid vesicles (preferably with a mixture of phosphatidylcholine and phosphatidylethanolamine at a 4:1 ratio).

This optimized protocol balances yield with functional integrity, crucial for downstream structural and pharmacological studies.

What methods can be used to validate the functional integrity of purified bovine DRD2?

Validating the functional integrity of purified bovine DRD2 requires multiple complementary approaches:

  • Ligand Binding Assays:

    • Saturation binding assays using [3H]spiperone to determine Kd and Bmax values

    • Competition binding assays with various agonists and antagonists to verify pharmacological specificity

    • The rank order of potency should follow the profile typical of D2 dopamine receptors

  • Receptor-G Protein Coupling:

    • GTPγS binding assays to measure G protein activation upon agonist stimulation

    • Reconstitution with purified G proteins (Gi/Go) in phospholipid vesicles to demonstrate agonist-stimulated GTPase activity

  • Covalent Labeling:

    • Use of affinity probes like 125I-bromoacetyl-N-(p-aminophenethyl)spiperone to verify the presence of intact binding sites

    • Validation that the Mr ~120,000 peptide contains the functional ligand binding domain

  • Conformational Analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Tryptophan fluorescence spectroscopy to monitor conformational changes upon ligand binding

  • Functional Reconstitution:

    • Verification that receptor function improves after reinsertion into phospholipid vesicles, with KD values shifting from 5-8 nM in detergent to approximately 160 pM in vesicles

Validation MethodExpected Result for Functional ReceptorInterpretation
[3H]spiperone binding (detergent)KD = 5-8 nMReceptor maintains basic binding capacity
[3H]spiperone binding (vesicles)KD ≈ 160 pMReceptor adopts native-like conformation
Agonist competitionHigh-affinity and low-affinity statesG protein coupling preserved
GTPγS bindingIncreased binding with agonistFunctional G protein activation
Covalent labelingSpecific labeling of 120 kDa bandIntact binding pocket

How do I design experiments to study the interaction between bovine DRD2 and G proteins?

Designing experiments to study bovine DRD2-G protein interactions requires a multifaceted approach combining biochemical, biophysical, and structural methods:

  • Reconstitution Systems:

    • Purify bovine DRD2 as described previously and reconstitute with purified G proteins (Gi/Go) in phospholipid vesicles

    • Create defined stoichiometric ratios of receptor:G protein for quantitative studies

    • Consider using miniG proteins, engineered G protein subunits that stabilize the active state of GPCRs

  • Functional Coupling Assays:

    • Measure agonist-stimulated GTPase activity in reconstituted systems

    • Perform [35S]GTPγS binding assays to quantify nucleotide exchange

    • Conduct BRET (Bioluminescence Resonance Energy Transfer) experiments in cell-based systems to monitor real-time coupling

  • Structural Studies:

    • Use cryo-electron microscopy to analyze DRD2-G protein complexes, similar to studies done with human D2R-Gi complexes

    • Stabilize complexes with agonists (e.g., bromocriptine) and stabilizing antibodies or nanobodies (e.g., scFv16)

    • Consider cross-linking approaches to capture transient interactions

  • Mutational Analysis:

    • Generate site-directed mutants in the intracellular loops and C-terminus of bovine DRD2

    • Focus on conserved motifs like the DRY motif in TM3 and the NPxxY motif in TM7

    • Assess impact on G protein coupling through functional assays

  • Comparative Analysis:

    • Compare bovine DRD2 coupling with human D2R coupling to identify species-specific differences

    • Analyze G protein specificity by testing coupling to different G protein subtypes (Gi1, Gi2, Gi3, Go)

When conducting these experiments, it's crucial to include appropriate controls:

  • Antagonist-bound receptor states (negative control for G protein activation)

  • Constitutively active mutants (positive control for G protein coupling)

  • GTPγS pre-treatment (to uncouple receptors from G proteins)

What are the key methodological considerations for analyzing DRD2 oligomerization?

DRD2 is known to form homo- and heterooligomers, particularly with DRD4, which may modulate agonist-induced downstream signaling . Analyzing DRD2 oligomerization requires specialized approaches:

  • Biochemical Approaches:

    • Chemical cross-linking to stabilize transient protein-protein interactions

    • Co-immunoprecipitation studies using differentially tagged receptor variants

    • Blue native PAGE to separate protein complexes in their native state

    • Size exclusion chromatography to analyze the molecular weight of receptor complexes

  • Biophysical Methods:

    • FRET (Fluorescence Resonance Energy Transfer) using fluorescently labeled receptors

    • BRET assays with luciferase-tagged and fluorescent protein-tagged receptors

    • Single-molecule imaging to visualize receptor clustering and dynamics

    • Fluorescence correlation spectroscopy (FCS) to determine diffusion coefficients

  • Functional Implications Assessment:

    • Compare signaling profiles of monomeric vs. oligomeric states

    • Analyze the impact of heterooligomerization with DRD4 on agonist binding and downstream signaling

    • Investigate how interactions with other partners (GPRASP1, PPP1R9B, CADPS, CADPS2, CLIC6, ARRB2, HTR2A, KCNA2) affect oligomerization

  • Structural Requirements:

    • Generate truncation mutants to identify domains involved in oligomerization

    • Use peptides corresponding to transmembrane domains to disrupt specific interfaces

    • Analyze the impact of cholesterol and membrane composition on oligomer stability

  • Physiological Relevance:

    • Design experiments to determine if oligomerization affects receptor trafficking

    • Study how oligomerization impacts receptor internalization and recycling

    • Analyze whether oligomeric state affects coupling to different signaling pathways

These methodologies must be carefully controlled to distinguish specific oligomerization from non-specific aggregation, particularly when working with detergent-solubilized receptors.

How should I design mutagenesis studies to investigate bovine DRD2 ligand binding domains?

Designing effective mutagenesis studies for bovine DRD2 ligand binding domains requires a systematic approach guided by structural information and conservation analysis:

  • Target Selection Strategy:

    • Use alignment with human D2R structures as a guide, since human D2R-ligand complexes have been resolved at high resolution

    • Focus on residues within the transmembrane helical bundle, particularly TM3, TM5, TM6, and TM7, which form the orthosteric binding pocket

    • Prioritize conserved residues that directly interact with catechol moieties of dopamine and related agonists

    • Include key residues like the conserved aspartate in TM3 (D3.32) which forms a salt bridge with the amine group of dopamine

  • Mutation Design:

    • Conservative mutations: Replace residues with similar amino acids to assess the importance of specific chemical properties

    • Alanine scanning: Systematically replace residues with alanine to identify essential side chains

    • Gain/loss of function mutations: Design mutations that might enhance or diminish binding of specific ligands

  • Experimental Validation:

    • Radioligand binding assays to determine affinity changes (Kd)

    • Competition binding assays to assess selectivity shifts

    • Functional assays (GTPγS binding, cAMP inhibition) to link binding site changes to signaling outcomes

  • Advanced Structural Analysis:

    • Consider hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with altered conformational dynamics

    • Use molecular dynamics simulations to predict the impact of mutations

    • For critical mutations, consider structural studies using cryo-EM or X-ray crystallography

Mutation TypeExampleRationaleExpected Outcome
Conserved D3.32 (TM3)D→NTest ionic interaction with amine groupMajor decrease in binding affinity
Serine residues in TM5S→ATest H-bonding with catechol groupsSelective reduction in catechol agonist binding
Hydrophobic pocket residuesF/W→ATest aromatic interactionsAltered ligand positioning
Extracellular loop residuesECL2 mutationsTest role in ligand accessChanged binding kinetics

What experimental approaches are recommended for studying DRD2-mediated signaling pathways?

Studying DRD2-mediated signaling pathways requires multiple complementary approaches targeting different levels of the signaling cascade:

  • G Protein-Dependent Signaling Assays:

    • cAMP assays: As DRD2 couples to Gi/Go proteins that inhibit adenylyl cyclase , measure reduction in forskolin-stimulated cAMP levels

    • GTPγS binding: Quantify nucleotide exchange on G proteins as a direct measure of receptor activation

    • BRET-based G protein activation sensors to monitor conformational changes in real-time

    • Electrophysiology in reconstituted systems or native cells to measure modulation of ion channels downstream of G protein activation

  • β-Arrestin Pathway Analysis:

    • BRET or FRET assays to monitor receptor-arrestin interactions

    • Confocal microscopy to track arrestin recruitment and receptor internalization

    • Phospho-specific antibodies to detect receptor phosphorylation by GRKs (G protein-coupled receptor kinases)

    • Signalosome analysis using proteomics approaches to identify components of arrestin-bound complexes

  • Downstream Effector Activation:

    • ERK1/2 phosphorylation assays to measure MAPK pathway activation

    • Ca2+ flux measurements to detect modulation of calcium signaling

    • Akt/PKB phosphorylation to assess effects on cell survival pathways

    • Gene reporter assays (e.g., CRE-luciferase) to measure transcriptional regulation

  • Biased Signaling Analysis:

    • Comparative quantitative analysis of G protein vs. arrestin pathways

    • Operational models to calculate bias factors for different ligands

    • Kinetic analysis to determine temporal patterns of pathway activation

  • In Vivo Signaling:

    • Phosphoprotein analysis in tissue samples after in vivo drug treatment

    • Use of biosensors in intact animals (e.g., fiber photometry with genetically encoded calcium indicators)

    • Behavioral readouts coupled with pharmacological or genetic manipulation

When designing these experiments, consider the following technical aspects:

  • Use multiple time points to capture both rapid and delayed responses

  • Include appropriate positive and negative controls

  • Validate key findings with both gain-of-function and loss-of-function approaches

  • Consider the impact of receptor expression levels on signaling outcomes

How can I establish an assay system to screen compounds for selectivity between DRD2 and other dopamine receptors?

Establishing a robust assay system for screening compound selectivity between DRD2 and other dopamine receptors requires a systematic approach:

  • Expression System Selection:

    • Create stable cell lines expressing individual dopamine receptor subtypes (D1, D2, D3, D4, D5)

    • Use the same host cell line for all receptors to minimize cell-specific effects

    • Ensure similar expression levels across cell lines by quantitative flow cytometry or radioligand binding

  • Primary Binding Assays:

    • Implement a high-throughput radioligand binding assay using [3H]spiperone or similar antagonist

    • Perform competition binding assays with test compounds against all receptor subtypes

    • Calculate Ki values using the Cheng-Prusoff equation to determine receptor subtype selectivity

  • Functional Assays:

    • For D2-like receptors (D2, D3, D4): Measure inhibition of forskolin-stimulated cAMP production

    • For D1-like receptors (D1, D5): Measure stimulation of cAMP production

    • Use BRET-based sensors to directly monitor G protein activation

    • Consider arrestin recruitment assays using enzyme complementation or BRET approaches

  • Selectivity Determination:

    • Calculate selectivity indexes (ratio of Ki or EC50 values between different receptor subtypes)

    • Generate selectivity matrices for compound libraries

    • Visualize selectivity data using heat maps or radar plots

  • Advanced Characterization:

    • For promising compounds, perform detailed pharmacological characterization including:

      • Binding kinetics (kon and koff rates)

      • Biased signaling profiles

      • Allosteric modulation potential

    • Molecular docking studies to understand structural basis of selectivity

Assay TypePurposeReadoutAdvantage
Radioligand bindingDirect binding affinityDisplacement of labeled ligandGold standard for affinity
cAMP measurementFunctional responseChanges in cAMP levelsCaptures receptor activation
BRET G protein activationDirect couplingEnergy transfer signalReal-time kinetic data
β-arrestin recruitmentAlternate pathwayProtein-protein interactionIdentifies biased ligands
GTPγS bindingG protein activationNucleotide exchangeDirect measure of G protein cycle

For high-throughput applications, consider developing a fluorescence-based screening platform or implementing bioluminescence-based detection systems.

How should I interpret contradictory results between different functional assays with bovine DRD2?

Contradictory results between different functional assays with bovine DRD2 are not uncommon and require systematic troubleshooting and interpretation:

  • Assay-Specific Factors:

    • Different assays measure distinct aspects of receptor function (binding, G protein activation, downstream signaling)

    • Each assay has unique sensitivity, dynamic range, and temporal resolution

    • Some assays detect proximal events (e.g., G protein coupling) while others measure distal outcomes (e.g., gene expression)

  • Methodological Considerations:

    • Examine whether discrepancies arise from differences in:

      • Receptor expression levels across systems

      • Buffer compositions affecting receptor conformation

      • Presence/absence of allosteric modulators

      • Detection time points (capturing different phases of signaling)

    • Consider if the receptor is properly folded and trafficked in each system

  • Receptor State Analysis:

    • DRD2, like other GPCRs, exists in multiple conformational states

    • Different assays may preferentially detect different receptor states

    • Consider the possibility of biased signaling, where ligands selectively activate certain pathways

  • Reconciliation Strategies:

    • Perform concentration-response curves across multiple assays with the same compounds

    • Calculate operational parameters (efficacy, potency) for systematic comparison

    • Use kinetic measurements to determine if temporal differences explain discrepancies

    • Implement receptor mutagenesis to identify state-specific signaling

  • Biological Interpretation:

    • Consider if contradictions reveal meaningful biological complexity rather than technical artifacts

    • Evaluate if the receptor exhibits system bias (different coupling efficiency in different cellular contexts)

    • Assess whether interacting proteins present in one system but not another explain the results

When faced with contradictory results, it's essential to:

  • Return to positive and negative controls to validate assay performance

  • Test reference compounds with well-characterized properties across all assays

  • Consider developing an integrated model that accommodates apparently contradictory findings

What statistical approaches are appropriate for analyzing dose-response data from DRD2 binding and functional studies?

Appropriate statistical analysis of dose-response data from DRD2 studies requires careful consideration of experimental design and pharmacological principles:

  • Curve Fitting Approaches:

    • Four-parameter logistic (4PL) model: Standard approach for sigmoidal dose-response curves

      • Y = Bottom + (Top-Bottom)/(1+10^((LogEC50-X)*HillSlope))

    • Three-parameter logistic model: Used when Hill slope is fixed at 1

    • Variable slope models: When cooperativity or multiple binding sites are present

    • Biphasic models: For data suggesting two distinct binding sites or receptor populations

  • Parameter Estimation and Comparison:

    • Use global fitting when comparing multiple curves to increase statistical power

    • Calculate confidence intervals for key parameters (EC50/IC50, Emax, Hill coefficient)

    • Apply extra sum-of-squares F-test to determine if curves differ significantly

    • Consider Akaike Information Criterion (AIC) for model selection

  • Handling Special Cases:

    • Incomplete curves: Apply constraints based on known maximal effects

    • Receptor depletion: Correct binding data using the Swillens correction

    • Partial agonism: Use operational models to calculate efficacy parameters

    • Biased signaling: Calculate bias factors using equiactive comparisons

  • Robust Statistical Practices:

    • Perform outlier analysis but avoid arbitrary data exclusion

    • Use appropriate transformations (e.g., log transformation of concentration values)

    • Account for repeated measures when applicable

    • Consider hierarchical/mixed models for complex experimental designs

  • Visualization Recommendations:

    • Always plot individual data points along with fitted curves

    • Use semi-logarithmic plots for dose-response relationships

    • Include error bars representing appropriate measures of variability

    • Use consistent axis scaling when comparing multiple conditions

Statistical ChallengeRecommended ApproachRationale
Comparing potenciesExtra sum-of-squares F-testAccounts for entire curve shape
Analyzing partial agonistsOperational model fittingSeparates affinity from efficacy
Multiple receptor statesTwo-site binding modelsCaptures high and low affinity states
System variabilityNormalize to reference compoundReduces day-to-day variability
Biased signalingΔΔlog(τ/KA) calculationQuantifies pathway-specific efficacy

These approaches should be implemented in appropriate statistical software packages such as GraphPad Prism, R, or specialized pharmacological analysis tools.

How can I correlate in vitro binding data with functional outcomes for bovine DRD2 receptors?

Correlating in vitro binding data with functional outcomes for bovine DRD2 receptors requires integration of multiple assay types and conceptual frameworks:

  • Binding-Function Correlation Approaches:

    • Plot binding affinity (pKi) against functional potency (pEC50) to identify:

      • Compounds that follow the expected correlation (binding affinity predicts function)

      • Outliers suggesting unique mechanisms (biased signaling, allosteric modulation)

    • Calculate efficiency ratios (EC50/Ki) to quantify the translation of binding to function

    • Consider efficacy measures (Emax, intrinsic activity) alongside potency metrics

  • Mechanistic Models Application:

    • Implement the operational model of agonism (Black & Leff) to derive transduction coefficients (τ/KA)

    • Apply the cubic ternary complex model for cases involving constitutive activity

    • Use receptor state models to explain divergence between binding and function

  • Multiple Pathway Analysis:

    • Compare binding affinity to potency across different signaling pathways:

      • G protein activation (GTPγS binding)

      • Second messenger production (cAMP inhibition)

      • ERK phosphorylation

      • β-arrestin recruitment

    • Generate "signaling fingerprints" for each compound to visualize multi-dimensional data

  • Structure-Activity Relationship Integration:

    • Identify structural features that correlate with:

      • High binding affinity but low functional activity (antagonists, weak partial agonists)

      • Moderate binding but high efficacy (efficient coupling)

      • Pathway-selective effects (biased ligands)

    • Use molecular modeling to rationalize unexpected binding-function relationships

  • Translational Relevance Assessment:

    • When possible, link in vitro parameters to:

      • Ex vivo tissue responses

      • In vivo pharmacological effects

      • Physiological outcomes in animal models

Analysis ApproachKey ParametersInterpretation
Binding vs. Function PlotCorrelation coefficient (r²)How well binding predicts function
Operational ModelTransduction coefficient (τ/KA)Combined measure of affinity and efficacy
Efficiency RatioEC50/KiTranslation of binding to function
Pathway ComparisonRelative activity (RA) valuesPathway preference
Residence Time Analysiskoff correlation with durationKinetic basis of effect

This comprehensive approach helps identify meaningful correlations while revealing compounds with unique properties that might be missed by simpler analyses.

What approaches can be used to study the dynamic conformational changes of bovine DRD2?

Studying the dynamic conformational changes of bovine DRD2 requires specialized techniques that can capture the receptor's inherent flexibility:

  • Spectroscopic Approaches:

    • Fluorescence spectroscopy: Introduce fluorescent probes at specific sites to monitor local conformational changes

    • FRET/BRET studies: Incorporate donor and acceptor pairs to measure distance changes during activation

    • EPR spectroscopy: Use site-directed spin labeling to detect changes in mobility and accessibility

    • NMR spectroscopy: For smaller receptor fragments or with selective isotopic labeling

  • Structural Biology Techniques:

    • Cryo-EM: Capture different conformational states in complex with various ligands and G proteins, similar to studies with human D2R

    • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): Map regions with different solvent accessibility in various states

    • Disulfide cross-linking: Introduce cysteine pairs to trap specific conformations

    • Footprinting methods: Use chemical or oxidative labeling to identify exposed regions

  • Computational Methods:

    • Molecular dynamics simulations: Model receptor flexibility over nanosecond to microsecond timescales

    • Normal mode analysis: Identify intrinsic motions of the receptor structure

    • Markov state models: Characterize the conformational landscape and transitions

    • Enhanced sampling techniques: Accelerate exploration of conformational space

  • Functional Approaches:

    • Biosensor integration: Insert conformationally sensitive fluorescent proteins into receptor loops

    • Nanobody probes: Use conformation-specific nanobodies to stabilize and detect specific states

    • Real-time kinetic measurements: Monitor conformational changes following ligand binding

    • Single-molecule studies: Track individual receptor molecules to observe conformational dynamics

  • Comparative Analysis:

    • State-specific antibodies: Generate antibodies that recognize distinct conformational states

    • Differential scanning fluorimetry: Measure thermal stability changes induced by different ligands

    • Pharmacological analysis: Use ligands with known bias profiles to probe state-specific effects

These approaches are most powerful when combined, as each technique has specific strengths and limitations. For example, cryo-EM provides high-resolution structural snapshots but limited dynamic information, while spectroscopic methods offer excellent temporal resolution but more limited structural detail.

How can I investigate the role of specific residues in bovine DRD2 function through site-directed mutagenesis?

Site-directed mutagenesis provides a powerful approach to investigate the role of specific residues in bovine DRD2 function, but requires careful experimental design:

  • Strategic Residue Selection:

    • Conserved motifs: Focus on known GPCR functional motifs (DRY, NPxxY, CWxP, toggle switch)

    • Binding pocket residues: Target amino acids predicted to interact directly with ligands

    • G protein interface: Examine residues in intracellular loops and TM regions that contact G proteins

    • Species-specific residues: Identify differences between bovine and human DRD2 sequences

  • Mutation Strategy Design:

    • Conservative substitutions: Replace with similar amino acids to probe specific chemical properties

    • Radical substitutions: Introduce dramatically different residues to disrupt function

    • Cysteine scanning: Systematically replace residues with cysteine for subsequent modification

    • Insertion of non-canonical amino acids: For precise control of electronic and steric properties

  • Functional Consequence Assessment:

    • Expression and trafficking: Verify proper folding and surface expression

    • Ligand binding: Measure affinity changes through radioligand binding

    • G protein coupling: Assess changes in G protein activation efficiency

    • Receptor dynamics: Determine effects on activation/inactivation kinetics

    • Biased signaling: Evaluate pathway-selective effects of mutations

  • Structural Interpretation:

    • Map mutations onto homology models based on human D2R structures

    • Use molecular dynamics to predict conformational consequences

    • Consider how mutations might affect water networks and hydrogen bonding patterns

    • Analyze potential allosteric effects propagating from mutation sites

  • Systematic Analysis Framework:

    • Create comprehensive mutation matrices for key regions

    • Develop structure-function maps correlating position with phenotype

    • Use double-mutant cycles to identify functionally coupled residues

    • Apply evolutionary analysis to interpret functional importance

Mutation TargetRationaleExpected OutcomeAssay Method
D3.32 (TM3)Primary ionic interaction with amine groupsAbolished bindingRadioligand binding
DRY motifG protein couplingReduced signalingG protein activation assays
Hydrophobic coreReceptor stabilityAltered expressionSurface ELISA, microscopy
ECL2 residuesLigand accessChanged binding kineticsAssociation/dissociation studies
TM5 serinesH-bond with catechol groupsSelective agonist effectsFunctional selectivity assays

When designing these experiments, include appropriate controls:

  • Wild-type receptor tested in parallel

  • Multiple mutation types at each position

  • Restoration mutations to recover function

  • Comparison with equivalent mutations in human D2R

What are the most significant challenges and future directions in bovine DRD2 research?

The study of recombinant bovine D(2) dopamine receptor presents several significant challenges while offering promising future research directions:

  • Current Technical Challenges:

    • Structural Stability: Maintaining the native conformation of bovine DRD2 during purification and reconstitution remains difficult despite advances in membrane protein techniques .

    • Expression Systems: Achieving sufficient yield of properly folded receptor continues to limit large-scale structural and biochemical studies.

    • Species Differences: Reconciling findings between bovine and human DRD2 models requires careful consideration of species-specific pharmacology and signaling.

    • Conformational Heterogeneity: Capturing the dynamic nature of DRD2 and correlating specific conformations with functional outcomes remains technically challenging.

  • Emerging Research Directions:

    • Comparative Structural Biology: High-resolution structures of bovine DRD2 in multiple states would complement existing human D2R structures and provide insights into species-specific differences in receptor pharmacology.

    • Synthetic Biology Approaches: Designer receptors based on bovine DRD2 could offer unique tools for manipulating dopaminergic signaling in research and therapeutic applications.

    • Systems Biology Integration: Placing DRD2 function within broader signaling networks will help understand its role in complex physiological processes.

    • Translational Applications: Using insights from bovine DRD2 to inform development of improved therapies for neuropsychiatric and endocrine disorders affecting dopaminergic systems.

  • Methodological Advances:

    • Cryo-EM Optimization: Adapting techniques used for human D2R to determine bovine DRD2 structures in complex with various ligands and effectors.

    • Single-Molecule Approaches: Developing methods to study individual receptor behavior in real-time within native-like environments.

    • Advanced Computational Modeling: Implementing molecular dynamics simulations at longer timescales to capture relevant conformational transitions.

    • Nanobody Development: Creating conformational state-specific nanobodies as tools for stabilizing and detecting specific receptor states.

  • Conceptual Frontiers:

    • Allosteric Modulation: Exploring beyond the orthosteric binding site to identify bovine-specific allosteric sites.

    • Receptor Dynamics: Understanding the energy landscape of receptor activation and how it differs between species.

    • Signaling Complexes: Characterizing the composition and function of macromolecular complexes formed by DRD2 with various interacting partners .

    • Multi-Receptor Integration: Investigating how DRD2 function is integrated with other neurotransmitter systems through receptor heteromerization and downstream crosstalk.

These challenges and directions highlight the complexity of DRD2 biology while pointing toward promising avenues for future research that could yield significant insights into dopaminergic signaling across species.

How can bovine DRD2 research contribute to understanding human dopaminergic systems?

Bovine DRD2 research offers valuable complementary insights to human studies, contributing to a comprehensive understanding of dopaminergic systems in several key ways:

  • Comparative Pharmacology Benefits:

    • Bovine DRD2 provides an evolutionary perspective on dopamine receptor function, helping identify conserved mechanisms essential to mammalian physiology.

    • Differences in ligand binding properties between bovine and human receptors can reveal species-specific adaptations and help define the core pharmacophore requirements for dopamine receptors.

    • The distinct glycosylation patterns observed in bovine DRD2 purification can illuminate how post-translational modifications influence receptor function across species.

  • Structural Insights:

    • The purified bovine receptor appears as a ~120,000 Da polypeptide , which can be compared with human D2R structures resolved through cryo-EM to identify structural conservation and divergence.

    • Bovine DRD2 can serve as an alternative template for homology modeling and drug design, potentially revealing binding pocket characteristics not evident in human receptor structures.

    • Comparative analysis of receptor dynamics may identify species-conserved conformational changes essential for activation versus species-specific regulatory mechanisms.

  • Signaling Mechanisms:

    • Studies showing that purified bovine D2 receptors mediate agonist stimulation of GTPase activity when reconstituted with brain Gi/Go provide a simplified system to study fundamental aspects of GPCR-G protein coupling.

    • Comparison of bovine and human DRD2 interactions with partners like DRD4, GPRASP1, PPP1R9B, and others can identify conserved protein-protein interactions essential for dopaminergic signaling.

    • Differences in signaling efficiency or bias between species may reveal evolutionary adaptations in dopaminergic system regulation.

  • Methodological Advantages:

    • Bovine tissue provides a relatively abundant source of native DRD2 for biochemical studies, complementing recombinant approaches.

    • Robust purification protocols established for bovine DRD2 can inform improved methods for human receptor isolation.

    • The availability of specialized tools like the Bovine DRD2 ELISA Kit enables quantitative analysis of receptor expression in various tissues and experimental conditions.

  • Translational Relevance:

    • Identifying pharmacological properties shared between bovine and human DRD2 helps establish foundational principles of dopamine receptor function relevant to human health and disease.

    • Comparing drug responses across species strengthens predictive models for therapeutic development targeting human dopaminergic systems.

    • Understanding species variations provides context for interpreting preclinical studies in animal models of dopamine-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.